KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100415174Help
Entry
100415174         CDS       T03264                                 

Gene name
NYAP1
Definition
(RefSeq) neuronal tyrosine phosphorylated phosphoinositide-3-kinase adaptor 1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
SSDB OrthologParalogGFIT
Motif
Pfam: NYAP_N NYAP_C
Motif
Other DBs
NCBI-GeneID: 100415174
NCBI-ProteinID: XP_002744088
Ensembl: ENSCJAG00000015307
UniProt: F6Y5A8
LinkDB All DBs
Position
2
AA seq 844 aa AA seqDB search
MNLLYRKTKLEWRQHKEEEAKRSSSKEVAPAGPAGPGAGQGPGVRVRDIASLRRSLRMGF
MTMPASQEHTPHPCRSAMAPRSLSCHSVGSMDSVGGGPGGGGGGLTEDSSTRRPPAKPRR
HPSTKLSMAGPGSGAETPPSKKAGSQKPTPEGRESSRKIPPQKPRRSPNTQLSVSFDESC
PQGPSPRGGNLPLQRLTRGSRVAGDPDVGAQEEPVYIEMVGDVFRGGGRSGGGLAGPPLG
GGGPAPPAGADSDSEESEAIYEEMKYPLPEEAGEGRTNGPPPLTATSPPHQPHALPTHAH
RRPASALPSRRDGTPTKTTPCEIPPPFPNLLQHRPPLLAFPQPKSASRTPGDGVSRLPVL
CHSKEPVGSTPAPQVPARERETPPPPPPPPAANLLLLGPSGRARSHSTPLPPQGSGQPRG
ERELPNSHSMICPKAAGVPVAPPAPAALLPAPPKDKAVSYTMVYSAVKVTTHSVLPAGPP
LGAGEPKTEKEISVLHGMLCTSSRPPMPGKSSPHGGPMGATAGVLHHRGCLASPHSLPDP
TAGSLTPLWTYPATAAGLKRPPAYESLKAGGVLNKGCGMGAPSPMVKIQLQEQGTDGGAF
ASISCAHVIASAGTPEEEEEEMGAATFGAGWALQRKVLYGGRRAKELDKIEDGARAWNGS
AEGPGKVEREDRGPVTSGIPVRSQGAEALLARIHHGGDRGGSRTSLPIPCQTFPACHRNG
DFTGGYRLGRSASTSGVRQVSLHTPRPCSQPRDAPSQPHPALPLPLPLPLPPQPARERDG
KLLEVIERKRCVCKEIKARHRPDRGLCKQESMPILPSWRRGPEPRKSGTPPCRRQHTVLW
DTAI
NT seq 2535 nt NT seq  +upstreamnt  +downstreamnt
atgaacctcctctaccgaaaaaccaagctggagtggaggcagcacaaggaagaggaggcc
aagaggagctccagtaaggaggtggcccccgcaggcccggctgggcccggggctggacag
gggcctggggtccgagtgcgggacatcgcctcgctgcggcgctccctcaggatggggttc
atgacgatgcctgcctcccaggagcacaccccgcacccctgccgcagcgccatggcccca
cgctccctctcctgccactcagtgggcagcatggacagtgtcgggggtggccccggcggg
ggcggtgggggcctcacagaggacagcagcacccgaagaccccctgccaagccccggaga
caccccagcaccaaactcagcatggcggggccggggtctggggcagagacgccccccagc
aagaaagcaggctcacagaagccaaccccggagggccgagagtccagccggaagattcct
ccgcagaagcccaggcgaagccccaacacccagctctctgtctcctttgatgagtcctgc
ccccaaggcccctctcctcgaggggggaacctgcctcttcagcgcctcactagggggtcc
cgagtagctggggaccctgatgtgggtgcccaggaagagcctgtgtacattgagatggtg
ggggacgtctttaggggaggaggacgaagtggaggaggccttgctgggccccctcttggg
ggtgggggcccagcccctccagcgggcgccgactcagactctgaagaaagtgaggccatc
tatgaggagatgaagtacccgttgccggaagaggctggggaaggccggaccaacggccct
cctccattgacggcaacatccccgccacaccagcctcacgcccttccaacccatgcccac
cgccgcccagcttcagccctcccgagccggagggacgggacgcccaccaagaccactcct
tgtgaaatccctccccccttccccaacctccttcagcaccggcctccactcctggccttc
ccccaacccaagtctgcttcccgaacccctggcgatggggtctcgaggctacctgtcctc
tgccactccaaggagccagtcggctccaccccagctccccaagtgcctgcacgggagcgg
gagacgcctcccccaccgcctccacctcctgctgccaacctgctgctgctgggaccatcg
ggccgggcccggagccactcaacaccattgccaccccagggctctggccagccccggggg
gagcgggaactccccaactcccacagcatgatctgccctaaggcggcgggggtgccggta
gcaccccctgccccggccgccttgctccccgccccccccaaggacaaggctgtgtcttac
accatggtgtactcggcggtcaaggtgaccacacactccgtcctgcccgccggtccaccc
ctgggtgctggggagccgaagacggagaaggagatctcagtcctccatgggatgctgtgt
accagctcgaggccccccatgccagggaaatccagcccccacggtgggcccatgggcgcg
acagctggggttctccaccaccgaggctgcctagcctccccccacagccttccagaccca
actgcaggctccctgaccccactgtggacctacccagctacagcagctgggctcaagaga
ccccctgcctatgagagcctcaaggctgggggggtgctgaataagggctgtggcatgggg
gccccatcccccatggtcaagatccagctgcaggagcaagggactgatgggggtgctttt
gccagcatctcctgtgcccatgtcatcgccagtgcagggacaccagaggaggaagaggag
gagatgggcgctgccacatttggagcaggctgggccctgcagaggaaggtcctctatgga
gggagaagagcaaaggagttggacaagatcgaggacggtgcccgtgcctggaatggcagt
gccgagggtccaggcaaggtagagcgtgaggacaggggccctgtgacatcggggatccca
gtgaggagccagggggcagaggccctgctggccaggatccaccatggaggagaccgagga
gggagccgcacctcgctgcccattccctgccagaccttccctgcctgccaccgaaatgga
gacttcacgggaggctaccgcctggggcgctcagcctccacttccggagtccggcaggtc
tcgctccacaccccccggccttgcagccagcccagggatgccccgagccagccccacccc
gcgctgccgctgccgctgccgctgccgctgccaccccagccggcccgcgagcgcgacggg
aagctgctggaggtgatcgagcgcaagcgctgcgtgtgcaaggagatcaaggcacgccac
cgccctgacagaggcctctgcaagcaggagagcatgcccatcctccctagctggcgtcgg
gggcccgagccccgcaaatccggcaccccgccctgccgccggcagcacacggtcctctgg
gataccgccatctga

DBGET integrated database retrieval system