KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100895892Help
Entry
100895892         CDS       T03264                                 

Gene name
FIP1L1
Definition
(RefSeq) factor interacting with PAPOLA and CPSF1
  KO
K14405  pre-mRNA 3'-end-processing factor FIP1
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    100895892 (FIP1L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cjc03019]
    100895892 (FIP1L1)
Messenger RNA biogenesis [BR:cjc03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     100895892 (FIP1L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fip1
Motif
Other DBs
NCBI-GeneID: 100895892
NCBI-ProteinID: NP_001257855
Ensembl: ENSCJAG00000018490
UniProt: F7HU47
LinkDB All DBs
Position
3
AA seq 588 aa AA seqDB search
MSAGEVERLVSELSGGTGGDEEEEWLYGDENEVERPEEENASANPPSGIEDETAENGVPK
PKVTETEDDSDSDSDDDEDDVHVTIGDIKTGAPQYGSYGTAPVNLNIKTGGRVYGTTGTK
VKGVDLDAPGSINGVPLLEVDLDSFEDKPWRKPGADLSDYFNYGFNEDTWKAYCEKQKRI
RMGLEVIPVTSTTNKITAEDCTMEVTPGAEIQDGRFNLFKVQQGRTGNSEKETALPSTKA
EFTSPPSLFKTGLPPSRNSTSSQSQTSTASRKANSSVGKWQDRYGRAESPDLRRLPGAID
VIGQTITISRVEGRRRANENSNIQVLSERSATEVDNNFSKPPPFFPPGAPPTHLPPPPFL
PPPPTVSTAPPLIPPPGIPITVPPPGFPPPPGAPPPSLIPTIESGHSSGYDSRSARAFPY
GNVAFPHLPGSAPSWPSLVDTSKQWDYYARREKDRDRERDRDRERDRDRDRERERTRERE
RERDHSPTPSVFNSDEERYRYREYAERGYERHRASREKEERHRERRHREKEETRHKSSRS
NSRRRHESEEGDSHRRHKHKKSKRSKEGKEAGSEPAPEQESTEATPAE
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgtcggccggcgaggtcgagcgcctagtgtcggagctgagcggcgggaccggaggggat
gaggaggaagagtggctctatggcgatgaaaatgaagttgaaaggccagaagaagaaaat
gccagtgctaatcctccatctggaattgaagatgaaactgctgaaaatggtgtaccaaaa
ccgaaagtgactgagactgaagatgatagtgatagtgacagtgatgatgatgaagatgat
gttcatgtcactataggagacattaaaacaggagcaccacagtatgggagttatggtaca
gcacctgtaaatcttaacattaagacaggaggaagagtttatggaaccacaggaacaaaa
gtcaaaggagtagaccttgatgcacctggaagcattaatggagttccacttttagaggta
gatttggattcttttgaagataaaccatggcgtaaaccgggtgctgatctttctgattat
tttaattatgggtttaatgaagatacttggaaagcttactgtgaaaaacaaaagaggata
cgaatgggacttgaagttataccagtaacctctactacaaataaaattacggccgaagac
tgtactatggaagttacaccaggtgcagagatccaagatggcagattcaatctttttaag
gtacagcagggaagaactggaaattcagagaaagaaacagcacttccctctacaaaagct
gagtttacttctcctccttctttgttcaagactgggctcccaccaagcagaaacagcacc
tcttctcagtctcagacaagtactgcctccagaaaagccaattcaagcgttgggaaatgg
caggatcgatatgggagggccgaatcacctgatctaaggagattacctggggcaattgat
gttattggtcagactataactatcagccgagtagaaggacggcgacgggcaaatgagaac
agcaacatacaggtcctttctgaaagatctgctactgaagtagacaacaatttcagcaaa
ccacctccatttttccctccaggagctcctcccactcaccttccacctcctccatttctt
ccacctcctccgactgtcagcactgctccacctctgattccaccaccgggtattccaata
actgtaccacctccaggttttcctcctccaccaggcgctccacctccatctcttatacca
acaatagaaagtggacattcctctggttatgatagtcgttctgcacgtgcatttccatat
ggcaatgttgcctttccccatcttcctggttctgctccttcatggcctagtcttgtggac
accagcaagcagtgggactattatgccagaagagagaaagaccgagatagagaaagagac
agagaccgagagcgagaccgtgatcgggatagagaacgagaacgcaccagagagagagag
agggagcgtgatcacagtcctacaccgagtgttttcaacagtgatgaagaacgctacaga
tacagggagtatgcagaaagaggttatgagcgtcacagagcaagtcgagagaaagaagaa
cgacatagagaaagacgacaccgggagaaagaggaaaccagacataagtcttctcgaagt
aatagtagacgtcgccatgaaagtgaagaaggagatagtcacaggagacacaaacacaaa
aaatctaaaagaagcaaagaaggaaaagaagctggcagtgagcctgcccctgaacaggag
agcaccgaagctacacctgcagaatag

DBGET integrated database retrieval system