KEGG   Callithrix jacchus (white-tufted-ear marmoset): 103793237Help
Entry
103793237         CDS       T03264                                 

Definition
(RefSeq) protein phosphatase 1E-like
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
SSDB OrthologParalogGFIT
Motif
Pfam: SPESP1
Motif
Other DBs
NCBI-GeneID: 103793237
NCBI-ProteinID: XP_008995551
LinkDB All DBs
Position
5
AA seq 160 aa AA seqDB search
MAGCIPEEKTYRRFLELFLGEFRGPCGGGEPEPEPEPEPEPEPESEPEPETDLVEAEAAE
ASVEEPREEAATVAATEQEDQEQDPELEEEAVEEEVVAVVEGEEEATAAAAPGHSAVPPP
PPPQPQLPPLPPLPRPLSERITREEVEGESLDLCLQQLYK
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atggccggctgcatccctgaggagaaaacttaccggcgcttcctggagctattcctgggc
gagtttcgcggaccgtgcggcggcggcgagccggagccggagccggaacccgaacccgag
cccgaacccgagtcagagcccgagcccgagactgacctggtagaagctgaggcggccgag
gcttcggtagaggaacctagggaggaggcggccacggtagccgcgacggagcaggaggac
caggagcaagacccggagctcgaggaggaagcggtggaagaggaggtggtggcggtagtt
gagggtgaggaggaggcgactgcggcggcagccccggggcactcagccgtaccgccgccg
ccaccgccgcagccccagctgccgccgttgccgccgctcccgcggccgctgtcggagcgc
atcacccgcgaggaggtggagggcgagagcctggacctgtgcctgcagcagctctacaaa
tag

DBGET integrated database retrieval system