KEGG   Callithrix jacchus (white-tufted-ear marmoset): 103794993Help
Entry
103794993         CDS       T03264                                 

Definition
(RefSeq) maltase-glucoamylase, intestinal-like
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00052  Galactose metabolism
cjc00500  Starch and sucrose metabolism
cjc01100  Metabolic pathways
cjc04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    103794993
   00500 Starch and sucrose metabolism
    103794993
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    103794993
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     103794993
    3.2.1.20  alpha-glucosidase
     103794993
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31
Motif
Other DBs
NCBI-GeneID: 103794993
NCBI-ProteinID: XP_009001198
LinkDB All DBs
Position
8
AA seq 286 aa AA seqDB search
MWIDMNEPSSFVNGAVPSGCRDASLNHPPYMPYLESRDRGLSSKSLCMESQQILPDGSPV
QHYNVHSLYGWSQTRPTYEAVQEVTGQRGVVITRSTFPSSGRWAGHWLGDNTAAWDQLKK
SIIGMMEFSLFGISYTGADICGFFQDAEYEMCVRWMQLGAFYPFSRNHNTIGTRRQDPVS
WDAAFVNISRNVLQTRYTLLPYLYTLMHKAHTEGVTVVRPLLHEFVSDQVTWDIDSQFLL
GPAFLVSPVLELVSMEASDRGRIPAVRLGEKNEEKRTELWGPTHGF
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgtggattgatatgaatgaaccatcgagcttcgtgaatggggcagttccttcaggctgc
agggatgcctctctgaaccaccctccctacatgccgtatttggagtccagggacaggggc
ctgagcagcaagagcctgtgcatggagagtcagcagatcctcccagacggctcccccgtg
cagcactacaatgtgcacagcctgtacgggtggtcccagaccagacccacatatgaagcc
gtgcaggaggtgactggacagcgaggggttgtcatcacccgctccacatttccctcttct
ggccgctgggcaggacattggctgggagacaacacggccgcgtgggatcagctgaagaaa
tctatcattggcatgatggagttcagcctctttggcatatcctacacaggagcagatatc
tgtggtttctttcaagacgccgaatatgagatgtgtgttcgctggatgcagctgggggcc
ttttaccccttctcaagaaaccacaacaccattgggactaggagacaagaccctgtatcc
tgggatgctgcttttgtgaatatttccagaaatgtcctgcagaccagatacaccctgttg
ccgtatctctataccttgatgcataaggcccacacggagggtgtcactgttgttcggcct
ctgctccatgagtttgtgtcagaccaggtaacatgggacatagacagtcagttccttctg
ggcccagccttcctggtcagccctgtcctggagcttgtgagtatggaggcctcagatcgg
gggaggatcccagctgtgaggctcggggagaagaatgaggagaagaggactgagctgtgg
ggtcctacacatggtttctaa

DBGET integrated database retrieval system