KEGG   Campylobacter jejuni subsp. doylei 269.97: JJD26997_1212Help
Entry
JJD26997_1212     CDS       T00573                                 

Gene name
ddlA
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
cjd  Campylobacter jejuni subsp. doylei 269.97
Pathway
cjd00473  D-Alanine metabolism
cjd00550  Peptidoglycan biosynthesis
cjd01100  Metabolic pathways
cjd01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cjd00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    JJD26997_1212 (ddlA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    JJD26997_1212 (ddlA)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    JJD26997_1212 (ddlA)
Enzymes [BR:cjd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     JJD26997_1212 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:cjd01011]
 Precursor biosynthesis
  Amino acid ligase
   JJD26997_1212 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_4 ATP-grasp_3 CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: ABS44797
UniProt: A7H451
LinkDB All DBs
Position
1064216..1065256
Genome map
AA seq 346 aa AA seqDB search
MKFAILFGGNSYEHEISIVSAVALKKVINQNLEFIFCDEERRFYHIPSEKMNSKTFSTKA
YKKEKELFIQQGGFFSKGFLKENKLECECVINLIHGGDGEDGKIAALFEFYSIKFIGPRL
EASVLSFNKELTKLYAKSVGVKTLDYTMLRKGQNSKEKLRFPCIIKPARLGSSIGISIVK
DEKDLEYAKDVGFEFDNDLVVEEFKNNIKEYNLAGCVINDKFVFSIIEEPKKKEFLDFEQ
KYLSFSGHNELIEANLSEELKEKLKDSFKKIYNPLFKGALIRCDFFILDNEVYLNEINPN
PGSLANYLFKDFSTTLNTLADQIPLEKMIKINYNFLHSINGQKGKL
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttgcaatactttttggcggaaattcttatgaacatgagatcagcatagtaagc
gctgttgcacttaaaaaagtcattaatcaaaatttagaatttattttttgtgatgaagaa
agaagattttatcatatcccaagtgaaaaaatgaattctaaaacttttagcactaaagct
tataaaaaagaaaaagaacttttcatacaacaaggaggtttttttagtaaaggtttttta
aaagaaaataaactagagtgcgagtgcgtgatcaatcttatccatggtggagatggagaa
gatggaaaaatcgcggctttatttgagttttattctattaaatttataggacctagactt
gaagctagcgtattatcttttaacaaggaacttactaaactttatgcaaaaagcgttgga
gtaaaaacacttgattataccatgctaagaaaagggcaaaactctaaagaaaagcttcgt
tttccttgtattatcaaacctgcaagacttggaagtagcataggcattagcatagtaaaa
gatgaaaaagatttagaatacgccaaagatgtaggttttgaatttgacaatgatcttgta
gtagaagaatttaaaaacaatatcaaagagtataatcttgcaggatgtgtgatcaatgat
aagtttgttttttccatcatagaagagccaaagaaaaaagaatttttagactttgaacaa
aaatatcttagcttttcaggacacaatgaacttatagaagcaaatttaagcgaagaatta
aaagaaaaactcaaagatagctttaaaaaaatttacaatcctttatttaaaggtgcttta
atacgctgcgatttctttatactagataatgaagtatatttaaatgaaatcaatccaaat
cctggttctttagctaattatctttttaaagattttagtaccactttaaacactttagct
gatcaaattccgcttgaaaaaatgataaaaatcaactacaacttccttcactccattaac
ggacaaaaaggaaaattataa

DBGET integrated database retrieval system