KEGG   Campylobacter jejuni subsp. doylei 269.97: JJD26997_1697Help
Entry
JJD26997_1697     CDS       T00573                                 

Gene name
fabZ
Definition
(GenBank) beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
cjd  Campylobacter jejuni subsp. doylei 269.97
Pathway
cjd00061  Fatty acid biosynthesis
cjd00780  Biotin metabolism
cjd01100  Metabolic pathways
cjd01212  Fatty acid metabolism
Module
cjd_M00083  Fatty acid biosynthesis, elongation
cjd_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:cjd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    JJD26997_1697 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    JJD26997_1697 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cjd01004]
    JJD26997_1697 (fabZ)
Enzymes [BR:cjd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     JJD26997_1697 (fabZ)
Lipid biosynthesis proteins [BR:cjd01004]
 Fatty acid synthase
  Component type
   JJD26997_1697 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT 4HBT_2
Motif
Other DBs
NCBI-ProteinID: ABS43827
UniProt: A7H598
LinkDB All DBs
Structure
PDB: 

Position
complement(1499872..1500312)
Genome map
AA seq 146 aa AA seqDB search
MIDVMQIQEILPHRYPFLLVDKITELKVKEVVRGYKNISISDHVFMGHFPGHPIYPGVLI
LEGMAQTGGVLAFESMEDKVDPKSKVVYFTGIDGAKFRNPVRPGDRLDYEMSVVKNRGNM
WIFKGQAFVDGNLVAEAELKAMIVDK
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgatagatgtaatgcaaattcaagaaatcttaccacaccgttatccttttttactagta
gataaaattacagaattaaaagttaaagaagtggtgcgaggatacaaaaacatcagtata
agtgatcatgtttttatgggacattttccaggacatcctatttatcctggagtcttgatt
ttagaaggtatggctcaaacaggtggagttttagcttttgaaagtatggaagataaagtg
gatccaaaaagtaaagtagtttatttcacaggtatagatggagcaaaatttagaaatcct
gtgcgtcctggtgatagacttgattatgaaatgagcgttgttaaaaatcgtggcaatatg
tggatttttaaagggcaagcttttgtagatggaaatttagttgcagaggctgagcttaaa
gctatgatagtggataaataa

DBGET integrated database retrieval system