KEGG   Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819: Cj0708Help
Entry
Cj0708            CDS       T00026                                 

Definition
(RefSeq) pseudouridine synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
cje  Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819
Brite
KEGG Orthology (KO) [BR:cje00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:cje03009]
    Cj0708
Enzymes [BR:cje01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     Cj0708
Ribosome biogenesis [BR:cje03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    Cj0708
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-GeneID: 905027
NCBI-ProteinID: YP_002344126
GeneDB: Cj0708
UniProt: Q0PAH1
LinkDB All DBs
Position
664968..665720
Genome map
AA seq 250 aa AA seqDB search
MQEKAYKLLALQEKISNREAKDLIDKGCVFSYGKKVVVARALMSDKARFNVIKAKNPQII
FEDDKIIAINKPYAYVSEDLEKKFNAKLLNRLDKETSGVILLCKDEDFRKLCIEEFKKHR
VYKSYIAVLDGVLAEEVEVNEPIFTIKVKGGALSKVSKDGLSALSIITPIMMQSKKTLAK
IVIQTGRTHQIRVHAKFIKHGVVGDEKYAKISSDRMYLHSYEIKIFNYHFRANLDSGFAK
FGFDIKNLDF
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaaaagcttataaactcttagctttgcaagaaaaaatttcaaatcgtgaagct
aaagatttgattgataagggttgtgttttttcatatggaaaaaaagttgtggttgctaga
gctttgatgagcgataaggcaagatttaatgtgataaaagctaaaaatcctcaaattatt
tttgaagatgataagattattgctattaataaaccttatgcttatgtgagtgaagattta
gagaaaaaatttaatgccaagcttttaaatcgtttagacaaagaaacaagtggtgtgatt
ttgctttgtaaagatgaagattttagaaagctttgtatagaagaatttaaaaaacacagg
gtttataaaagttatattgcggttttagatggggttttggctgaagaggttgaagtgaat
gaacctatttttactataaaagtaaaaggcggggcgttaagtaaagtttcaaaagatggt
ttaagtgccttaagtatcattactcctatcatgatgcagtcaaaaaaaaccttagcaaaa
atagttattcaaacaggtagaactcatcaaatcagagtgcatgctaaatttataaaacat
ggcgttgtaggtgatgaaaaatatgctaaaatttcaagcgatagaatgtatttgcatagc
tatgaaattaaaatttttaattatcattttagggctaatttagatagtggttttgcaaaa
tttggctttgatataaaaaatttagatttttaa

DBGET integrated database retrieval system