KEGG   Campylobacter jejuni subsp. jejuni 00-2425: N135_00485Help
Entry
N135_00485        CDS       T02844                                 

Definition
(GenBank) succinate dehydrogenase
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
cjei  Campylobacter jejuni subsp. jejuni 00-2425
Pathway
cjei00020  Citrate cycle (TCA cycle)
cjei00190  Oxidative phosphorylation
cjei00650  Butanoate metabolism
cjei01100  Metabolic pathways
cjei01110  Biosynthesis of secondary metabolites
cjei01120  Microbial metabolism in diverse environments
cjei01130  Biosynthesis of antibiotics
cjei01200  Carbon metabolism
Module
cjei_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cjei_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cjei00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    N135_00485
   00650 Butanoate metabolism
    N135_00485
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    N135_00485
Enzymes [BR:cjei01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     N135_00485
    1.3.5.4  fumarate reductase (quinol)
     N135_00485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C DAO HI0933_like Pyr_redox_2 Thi4 TAT_signal UCR_Fe-S_N FAD_binding_3 Lycopene_cycl NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AGV56270
LinkDB All DBs
Position
444226..446061
Genome map
AA seq 611 aa AA seqDB search
MGEFSRRDFIKTACISVGALAASSSGVYALDDSSKMDKDINLPSCDVLVIGSGGAGLCAA
AAVRKENPKLSVVVATKMMPSRNATCMAEGGINGVTDFSNGDSYKLHAYDTIKGGAYLVD
QDAALKFCELAGKAIFNMDFIGTLFSRNEQGGVAQRLMGGASKKRCNYSADKTGHILMHS
CLDDAISSGVKFLMNHELLDIGVVDGKCEGVVLRDIQSGGIYPVLCKALVIATGGYTRIF
YNRTSTPFIATGDGVAAALRAGLGFEDPEMIQFHPTGVANGGTLITEAARGEGGYLLNNR
GERFMKNYHEKMELAPRDVVARAIETEIREGRGYGEGLGAYVLCDVRHLGKEKILKDLPK
IRHTAMLFENIDLVDTPVPIRPTAHYSMGGIEVAKFEDMGTKIAGIYVGGEASCISIHGA
NRLGGNSLADAVVTGHLAGIGATNYAKDASFGKGAKTHELAQKWQVRFKEITNNGGNGQE
MYELREELGSQNWDNMGIFRTQEKLDLLAKKLEDIQARYEKIRIPNPNEVMNTAFTDYVE
LGNLILLSRCACLAARNRLESRGAHTREDYPKRDDKNFLKHSIVNLENDELKLSYKDVVV
TEFSLDGRRVQ
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaattttctagaagagattttataaaaacagcctgtattagtgtaggagcttta
gctgcaagttcaagtggagtttatgctttagatgattcatctaagatggataaagatata
aatttaccttcttgcgatgttttggtaattggatcaggtggagcaggtttgtgtgctgca
gccgcagtgagaaaagaaaatccaaaattaagcgttgtagtagctacaaagatgatgcca
tcgcgtaacgcaacttgtatggcagagggtggaattaatggagttactgatttttctaat
ggagattcctataaattacatgcttatgatactattaaaggcggagcttatttggtagat
caagatgcggctttaaaattttgcgaattagctggaaaggctatttttaatatggatttt
ataggaaccttgttttcaagaaatgagcaaggtggagtagctcagcgtttaatgggagga
gcttctaagaaacgctgtaactattctgcagataaaacaggtcatattttaatgcattct
tgtttagatgatgctattagtagtggtgtgaaatttttaatgaatcatgaacttttggat
ataggtgttgtggatggaaaatgcgagggtgtcgttttaagagatatacaaagcggtgga
atttatcctgtgttatgcaaagctttggtgattgctacagggggatacacaaggatattt
tataatagaacttcaactccttttattgccacaggagatggtgtggcagctgctcttaga
gcaggacttggttttgaagatcctgagatgatacaatttcacccaacaggagttgcaaat
ggtggaactcttattacagaagcggcgcgcggtgaagggggatatcttttaaataatcgt
ggtgagcgttttatgaaaaattaccatgaaaaaatggagcttgcaccgcgagatgtggtt
gcgcgtgctatagaaacagaaattcgtgaaggtagaggttatggcgagggacttggagct
tatgttttgtgcgatgtacgccacttaggaaaagaaaaaattttaaaagatttaccaaaa
attcgtcacactgcaatgctttttgaaaatattgatttagtagatactcctgtacctatc
cgtccaacggcgcattattctatgggtggaattgaagtggctaaatttgaagatatgggt
actaaaattgctggaatttatgtaggtggagaagcttcttgcatttctatacatggagct
aatagactagggggaaattctttagccgatgcagttgtaacagggcatttagcaggcatt
ggtgcgacaaattatgctaaagatgcaagttttggaaaaggggcaaaaactcatgaactt
gctcaaaaatggcaggttagatttaaagaaattacaaataatggcggaaatggtcaagaa
atgtatgaattgcgagaagagctaggaagtcaaaattgggataatatggggatttttaga
actcaagaaaaactcgatcttctagcaaaaaaattagaagatatacaagcgagatatgaa
aaaattcgtattccaaatcctaatgaagtgatgaatactgcttttacagattatgtagag
cttggtaatttgattttactttctcgctgtgcttgtttagcagctagaaatagacttgaa
agccgtggggctcatactagagaagattatccaaagcgagatgataaaaatttcttaaaa
catagcattgtaaatttagaaaatgatgaattaaaacttagttataaagatgtcgtggta
actgagttttcacttgatggaaggagagtacaatga

DBGET integrated database retrieval system