KEGG   Campylobacter jejuni subsp. jejuni 00-2425: N135_00486Help
Entry
N135_00486        CDS       T02844                                 

Definition
(GenBank) (2Fe-2S)-binding protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
cjei  Campylobacter jejuni subsp. jejuni 00-2425
Pathway
cjei00020  Citrate cycle (TCA cycle)
cjei00190  Oxidative phosphorylation
cjei00650  Butanoate metabolism
cjei01100  Metabolic pathways
cjei01110  Biosynthesis of secondary metabolites
cjei01120  Microbial metabolism in diverse environments
cjei01130  Biosynthesis of antibiotics
cjei01200  Carbon metabolism
Module
cjei_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cjei_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cjei00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    N135_00486
   00650 Butanoate metabolism
    N135_00486
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    N135_00486
Enzymes [BR:cjei01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     N135_00486
    1.3.5.4  fumarate reductase (quinol)
     N135_00486
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_9 Fer4_8 Fer4_17 Fer2 Fer4_7 Fer4_10 Fer4_16 Fer4 Fer4_21
Motif
Other DBs
NCBI-ProteinID: AGV56271
LinkDB All DBs
Position
446058..447023
Genome map
AA seq 321 aa AA seqDB search
MKIIIDRFNGKEKYEQSYDIDDKDIQGKTLLSLLLFIKKTKDITLNFTASCQSAICGACA
VRVNGHSYLACDTKMQDLLKEYDNPSSIRISPLGNFRVISDLIVDWEPSIENLRKIRPAM
VAKNEFSAEKGCKQSQEEFDRISKQWDCILCGSCASECNKLEADSSDYMQPFVFTHVWRA
AADSRGKDPMLHVKPSVMNGLWLCVHCQECADRCPKGISSVSDIANLRVMAIKKGLNEGL
GPDHAEAFYKDLVEGSGRLNEIYLALRSEGVIGSMGKTDIAFKLMRAGKMNPMHVFGEGE
IEGYKDLVKMIKAAQEAAVKE
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattatcatagatcgttttaatggcaaggaaaaatatgaacaaagttatgatatt
gatgataaggatatacaaggaaaaactctgctctctcttttgctttttatcaaaaaaaca
aaagatattactttaaattttaccgcctcttgtcaatctgcaatttgtggggcttgtgca
gttcgtgtgaatgggcattcttatcttgcttgtgatactaaaatgcaagatttgttaaaa
gaatatgataatccttcaagtatacgcatttctccgcttggaaattttagagtaatttct
gatttaattgtggattgggaaccttctatagaaaatttaagaaaaattcgtcctgccatg
gtggcaaaaaatgaattttcagcggaaaagggctgtaaacaaagtcaagaagaatttgat
cgtattagcaagcaatgggattgtattttatgtggtagctgtgcttcagagtgtaataaa
ttagaagcagatagtagcgattatatgcaaccttttgtttttactcatgtttggcgtgca
gcggcggactctcgaggtaaggatcctatgttgcatgtaaaacccagcgtaatgaatgga
ctttggctttgtgttcattgtcaagagtgcgctgatcgttgtccaaagggtataagttca
gtaagtgatatagcaaatttaagagtgatggcgattaaaaaaggtttaaatgaaggctta
gggcctgatcatgctgaagctttttataaagatttagttgaaggttcaggacgcttgaat
gaaatttatcttgctttgcgttctgagggtgttataggttctatgggtaaaacagatata
gcttttaaacttatgcgtgcaggaaaaatgaatcctatgcatgtttttggcgagggtgaa
atagaagggtataaagatttggttaaaatgataaaggcggcacaagaagctgctgttaag
gagtaa

DBGET integrated database retrieval system