KEGG   Campylobacter jejuni subsp. jejuni 00-2425: N135_01489Help
Entry
N135_01489        CDS       T02844                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
cjei  Campylobacter jejuni subsp. jejuni 00-2425
Pathway
cjei00061  Fatty acid biosynthesis
cjei00780  Biotin metabolism
cjei01100  Metabolic pathways
cjei01130  Biosynthesis of antibiotics
cjei01212  Fatty acid metabolism
Module
cjei_M00083  Fatty acid biosynthesis, elongation
cjei_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:cjei00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    N135_01489
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    N135_01489
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    N135_01489
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cjei01004]
    N135_01489
Enzymes [BR:cjei01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     N135_01489
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     N135_01489
Lipid biosynthesis proteins [BR:cjei01004]
 Fatty acid synthase
  Component type
   N135_01489
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase KR
Motif
Other DBs
NCBI-ProteinID: AGV57212
LinkDB All DBs
Position
complement(1412334..1413158)
Genome map
AA seq 274 aa AA seqDB search
MIMKGKKGLIVGVANNKSIAYGIAKACFDQGAELAFTFLNDALKKRVEPIAQEFNSNFVY
ELDVNNNEHLDSIAEKIKKDLGEIDFVVHAVAFAPKEALENSFLETSKEAFDIAMQTSVY
SLLSLTRAVLPILKDKGSILTLSYLGGVKYVPHYNVMGVAKAALESSVRYLARDLGVKGI
RVNAISAGPIKTLAASGIGDFRMILKYNEINSPLKRNVSIEDVGNSAMYLLSDLANGVTG
EIHYVDAGYNIMGMGDVEKNEEGQTVLCWDNQKG
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgattatgaagggtaaaaaaggccttattgtaggggttgcaaataataaatctattgct
tatggcatagcaaaagcatgttttgatcaaggagccgagcttgcttttacttttttaaat
gatgctttaaaaaaacgcgtagaacctatagcacaagagtttaattctaattttgtttat
gagcttgatgtaaataataacgagcatttagattctatcgctgaaaaaatcaaaaaagat
ttaggcgagattgattttgtagtgcatgcggttgcttttgctccaaaagaagctttagaa
aattcttttttagaaacttcaaaagaagcttttgatatagctatgcaaacttctgtgtat
tctttactttctttaacacgtgcggttttacctattttaaaagataagggttcgattttg
actttaagttatcttggtggggttaaatatgtacctcattataatgttatgggtgtagca
aaagccgcacttgaaagttctgtgcgttatttagcaagagatctaggagtaaaaggaatt
cgtgttaatgctatttcagcaggtcctattaaaactttggcagcaagtggaataggggat
tttagaatgattttaaaatacaatgaaatcaattctcctttaaaacgcaatgttagtata
gaagatgtaggtaattcggctatgtatttacttagcgatttagcaaatggtgttacaggt
gaaatacattatgttgatgcaggatataacatcatgggtatgggcgatgttgaaaaaaat
gaagaagggcaaactgttctttgttgggataatcaaaaaggataa

DBGET integrated database retrieval system