KEGG   Campylobacter jejuni subsp. jejuni 00-2426: N564_00121Help
Entry
N564_00121        CDS       T02841                                 

Definition
(GenBank) inositol monophosphatase
  KO
K01092  myo-inositol-1(or 4)-monophosphatase [EC:3.1.3.25]
Organism
cjej  Campylobacter jejuni subsp. jejuni 00-2426
Pathway
cjej00521  Streptomycin biosynthesis
cjej00562  Inositol phosphate metabolism
cjej01100  Metabolic pathways
cjej01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cjej00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    N564_00121
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    N564_00121
Enzymes [BR:cjej01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.25  inositol-phosphate phosphatase
     N564_00121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Inositol_P FBPase
Motif
Other DBs
NCBI-ProteinID: AGV50455
LinkDB All DBs
Position
complement(129785..130507)
Genome map
AA seq 240 aa AA seqDB search
MKEFLDACLNANLQIRKYLNNIPQNDLKLCSKLGYDKNQGYELDLKCEQIFIKYLSCFGQ
IFSEESGLIGKASPKQMILDPLDGSSNFVSKIPFYGTSIALMEKDQAKSAFVCNLVSQEI
FAFNNKQAFKSNLSDPKYSPLTPNLFSKIGIVEKISLYPELLDFLTKNQLKFRSLGATAL
SLAYASYFSFVLILGKTRIFDTAAALAIHQNLYIEKNENFLLLSQDKKIFDIILEFLKNN
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaatttttagatgcttgcttgaatgcaaatttgcaaatacgcaagtatctaaac
aatatcccacaaaatgatcttaaactttgctctaaattaggctatgataaaaatcaaggc
tatgagcttgacttaaaatgtgaacaaattttcataaaatatcttagttgttttggacaa
attttttctgaagaaagcggattgatcggaaaagctagcccaaaacaaatgattcttgat
cctttggatggaagttcaaattttgtttctaaaataccattttatggaacttctatagct
cttatggaaaaagatcaggcaaaaagtgcttttgtttgcaatcttgtcagtcaagaaatt
tttgcttttaataacaaacaagcttttaaatccaatctttccgatccaaaatactcaccc
ttaacacctaatctattttctaaaataggtatagttgaaaaaatttcactttatccagaa
cttctcgattttttaacaaaaaatcaattaaaatttcgctctttgggtgcaacagcctta
agtcttgcttatgcttcgtattttagttttgtattaattcttggaaaaacacgaattttt
gatacagcagctgctttagcaattcatcaaaatttatatatagaaaaaaatgaaaatttc
cttctcctaagccaagacaaaaaaatttttgatataatcttagaatttttaaaaaataat
tag

DBGET integrated database retrieval system