KEGG   Campylobacter jejuni subsp. jejuni 00-2426: N564_00688Help
Entry
N564_00688        CDS       T02841                                 

Definition
(GenBank) glycyl-tRNA synthetase subunit alpha
  KO
K01878  glycyl-tRNA synthetase alpha chain [EC:6.1.1.14]
Organism
cjej  Campylobacter jejuni subsp. jejuni 00-2426
Pathway
cjej00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:cjej00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    N564_00688
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cjej01007]
    N564_00688
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cjej03016]
    N564_00688
Enzymes [BR:cjej01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     N564_00688
Amino acid related enzymes [BR:cjej01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   N564_00688
Transfer RNA biogenesis [BR:cjej03016]
 Prokaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    N564_00688
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2e
Motif
Other DBs
NCBI-ProteinID: AGV51012
LinkDB All DBs
Structure
PDB: 

Position
663720..664583
Genome map
AA seq 287 aa AA seqDB search
MTFSQMILNLQNYWQEQGCAIMQPYDMPAGAGTFHPATFLRSLGKKPWAAAYVAPSRRPT
DGRYGENPNRLGAYYQFQVLIKPSPDNIQELYLKSLENLGFDLKSHDIRFVEDNWESPSL
GAWGLGWEVWLDGMEVTQFTYFQQVGGIAVDLVSAEITYGLERIAMYLQNVDNVYDIVWS
EFNGEKIKYADVHKQSEYEFSKYNFEVSDVKILNEQFENSYKECKNILEQGLALPAYDYC
MLAAHTFNLLDARGAISVAQRQDYMLKIRELSKNCAEIYKKNLNEAE
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgactttttcacaaatgatacttaatttacaaaattattggcaagagcaaggttgtgcg
attatgcaaccttatgatatgccagcaggtgcaggaacctttcatccagcaactttttta
agaagtttaggaaaaaaaccttgggcagctgcttatgtggctccaagtagaaggcctact
gatggacgttatggtgaaaatcctaatcgcttaggtgcttattatcaatttcaagtttta
attaaacctagtcctgataatattcaagaattatatcttaaaagtcttgaaaatttgggt
tttgatttaaaaagtcatgatattcgttttgttgaagataattgggagagtccaagtttg
ggtgcttggggtttaggctgggaagtatggcttgatggtatggaagttactcaatttact
tattttcagcaagttggcggtatagcagtagatttagtaagtgctgaaattacctatggt
cttgaaagaatagccatgtatcttcaaaatgttgataatgtttatgatatagtttggagt
gaatttaatggagaaaaaattaaatacgcagatgtgcataagcaaagtgaatatgaattt
agtaaatacaattttgaagtaagtgatgttaaaatcttaaatgagcagtttgaaaattct
tacaaagaatgtaaaaatattttagaacaaggactagctttacctgcttatgattattgt
atgcttgctgcacatacttttaatcttttagatgcaagaggagcaatttctgtagcacaa
agacaagattatatgttaaaaattcgtgaactttcaaaaaattgtgctgaaatttataag
aaaaatttaaatgaagctgagtga

DBGET integrated database retrieval system