KEGG   Campylobacter jejuni subsp. jejuni 00-2426: N564_01160Help
Entry
N564_01160        CDS       T02841                                 

Gene name
gatB
Definition
(GenBank) glutamyl-tRNA amidotransferase
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
cjej  Campylobacter jejuni subsp. jejuni 00-2426
Pathway
cjej00970  Aminoacyl-tRNA biosynthesis
cjej01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cjej00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    N564_01160 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cjej03029]
    N564_01160 (gatB)
Enzymes [BR:cjej01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     N564_01160 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     N564_01160 (gatB)
Mitochondrial biogenesis [BR:cjej03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    N564_01160 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AGV51475
LinkDB All DBs
Position
complement(1130704..1132122)
Genome map
AA seq 472 aa AA seqDB search
MFEVVIGLEVHAQLNTKTKIFCSCATSFGEAPNTNVCPTCLALPGALPVLNEEAVKKAIA
FGKAVNATINKKSVFNRKNYFYPDLPKAYQISQFDIPIVEKGELFINVKGENKRIGITRA
HLEEDAGKNIHESNFSKVDLNRAGTPLLEIVSEPELRSSDEAVAYLKKLHSIIRFLDISD
ANMQEGSFRCDANVSIRPKGDTKLYTRVEIKNLNSFRFIQKAIEYEVKRQSEAWEDGTYE
QEVVQETRLFDTTNLVTRSMRGKEEAAEYRYFPDPDLLPVLLKDEFLDIKIPELPDEKKV
RFIDKLGIKESDAEVLISSLEMSRFFESLISQNLNPKLCVNWLNTELMGLLKGELTIENS
PVDAQKLGVLIKRIEDGTISAKAAKDVLAFVFENTSVEIDEAIEKLGLKQVSDDSAIEAV
IEQILNANADKVAEYKSGKDKLFGFFVGQTMKEGKGAFNPAKVNEILKTKLG
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaagtagttataggtcttgaagttcatgctcagttaaatacaaaaacaaaaatc
ttttgctcatgtgcaacttcttttggagaagctccaaataccaatgtttgtcccacttgt
ttggccttaccaggagctttgcctgttttaaatgaagaggctgtaaaaaaagctatagct
tttggaaaagctgtcaatgcaacaattaataaaaaaagtgtttttaatcgtaagaattat
ttttatccagatttacctaaggcttatcaaatttcacaatttgatatccctatagtagaa
aagggtgagctttttatcaatgtaaagggtgaaaataaacgcataggtattacaagagcg
cacttggaagaagatgcaggtaaaaatatccatgaaagtaatttttctaaagtagattta
aatcgtgcaggaactcctttgcttgagattgtcagtgagcctgagcttagaagtagcgat
gaggcagtagcttatcttaaaaaacttcattctattatacgctttttagacatttcagat
gcaaatatgcaagaaggaagttttagatgcgatgcaaatgttagtataagacctaagggc
gatacaaaactttatactagagtagagattaaaaatcttaattcttttcgttttatccaa
aaagctatagaatatgaggtaaaaagacaaagtgaggcttgggaagatggaacttacgaa
caagaagtagttcaagaaactagactttttgatacgacaaatttagttacaagaagtatg
cgtggcaaagaagaagcggcagaatatcgctattttcctgatcctgatttattgcctgtt
ttattaaaagatgagtttttggatattaaaatccctgagcttcctgatgagaagaaagta
cgctttatagacaagcttggtataaaagaaagtgatgcagaggttttaatcagttcttta
gaaatgagtcgtttttttgaaagtcttatttctcaaaatttaaatcctaaactttgcgta
aattggttaaatactgaacttatgggacttttaaaaggagaattgactatagaaaattct
cctgtagatgctcaaaagcttggagttttaattaaacgcatagaagatggcactatcagt
gcaaaagcggctaaagatgtcttagcttttgtatttgaaaatactagcgtggaaattgat
gaagctatagaaaagctaggacttaagcaagtaagtgatgattcagccatagaagcggtg
attgaacaaattttaaatgcaaatgccgataaggttgcagagtataaaagtggtaaagac
aagctttttggattttttgtgggtcaaacaatgaaagaaggcaaaggagcttttaatcct
gcaaaagtaaatgaaattttaaaaacaaagcttggttga

DBGET integrated database retrieval system