KEGG   Campylobacter jejuni subsp. jejuni 00-2426: N564_01305Help
Entry
N564_01305        CDS       T02841                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
cjej  Campylobacter jejuni subsp. jejuni 00-2426
Pathway
cjej00620  Pyruvate metabolism
cjej01100  Metabolic pathways
cjej01120  Microbial metabolism in diverse environments
cjej01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cjej00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    N564_01305
Enzymes [BR:cjej01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     N564_01305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: malic Malic_M AlaDh_PNT_C ELFV_dehydrog ThiF 2-Hacid_dh_C Pyr_redox FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AGV51617
LinkDB All DBs
Position
complement(1260222..1261457)
Genome map
AA seq 411 aa AA seqDB search
MNLKEEALKYHLGGKIDIVPSKPMATSYDLSLAYSPGVAEPCLEIAKDNELAYTYTNKAN
LVAIVSDGSAVLGLGNIGAQASKPVMEGKACLFKKFANVNAYDIEINVHSIEEIVNFCKA
LAPTVGGINLEDIAAPKCFEIEAALQDLGIPVMHDDQHGTAIISTAGLMNAMEISGKKFK
DIKVVVSGAGAAGIASAKMYRNLGVENIILVDSKGVISKDRNDLTPQKLEFAVDSKEKTL
KEVLKGADVFLGLSAPKILDDEMVLSMAKDPVIFALANPIPEVMPEDVARLRKDAIVGTG
RSDYPNQINNVLGFPFIFRGALDVRASKITENMKVAAAKALADLAKLPVSDAVKKAYNLS
TLEFGRDYVIPKPFDERVKAAVSTAVAAAAVKDGVAKVKNFDEKAYFESLK
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaaaagaagaagctttaaaataccatttaggtgggaaaattgatattgtgcca
agtaagccaatggctacaagttatgatctatctttggcgtatagcccaggagttgcagaa
ccttgccttgaaatcgctaaagataatgagcttgcttatacttatacaaataaagctaat
ttggtagctatagttagcgatggttctgctgttttaggacttggaaacataggagcacag
gcttcaaaacctgttatggaaggtaaggcttgtttgtttaaaaaatttgcaaatgtaaat
gcttatgatatagaaattaatgttcatagtatagaagagattgtaaatttttgcaaggct
ttggctccgactgtgggcgggataaatttagaagatatagctgctccaaaatgttttgaa
attgaagcggctttgcaagatttaggaattcctgtaatgcatgatgatcagcacggaaca
gctattatttcaactgcagggcttatgaatgctatggagataagtggtaaaaaatttaaa
gacattaaggtggttgtaagtggcgcaggtgccgcaggtatagcaagtgctaagatgtat
agaaatttaggggttgaaaatattattttagtagatagtaaaggagtgatttctaaagat
agaaatgatttaactcctcaaaaacttgaatttgctgttgattctaaggaaaagacttta
aaagaagttttaaaaggagctgatgttttcctaggacttagtgcaccaaaaattcttgat
gatgaaatggttttaagcatggcaaaagatcctgtgatttttgctttggcaaatcctatc
cctgaagtgatgcctgaagatgtggctagacttagaaaagatgcgattgtaggaacagga
agaagtgattatccaaatcaaatcaataatgttttaggttttccttttattttccgtggg
gctttagatgtgcgtgcaagtaaaatcactgaaaatatgaaagtagcggctgctaaagca
ttagcagatcttgcaaaacttcctgtaagcgatgcggttaaaaaagcttataatttaagc
actttagaatttggaagagattatgttataccaaaaccttttgatgaaagagtaaaagct
gcagtaagtacagctgtagcagcagctgcggtaaaagatggtgtagctaaggtgaaaaat
tttgatgagaaagcttattttgaaagcttaaaatga

DBGET integrated database retrieval system