KEGG   Campylobacter jejuni subsp. jejuni 00-2544: N755_00467Help
Entry
N755_00467        CDS       T02843                                 

Definition
(GenBank) succinate dehydrogenase
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
cjen  Campylobacter jejuni subsp. jejuni 00-2544
Pathway
cjen00020  Citrate cycle (TCA cycle)
cjen00190  Oxidative phosphorylation
cjen00650  Butanoate metabolism
cjen01100  Metabolic pathways
cjen01110  Biosynthesis of secondary metabolites
cjen01120  Microbial metabolism in diverse environments
cjen01130  Biosynthesis of antibiotics
cjen01200  Carbon metabolism
Module
cjen_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cjen_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cjen00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    N755_00467
   00650 Butanoate metabolism
    N755_00467
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    N755_00467
Enzymes [BR:cjen01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     N755_00467
    1.3.5.4  fumarate reductase (quinol)
     N755_00467
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C DAO HI0933_like Pyr_redox_2 Thi4 TAT_signal UCR_Fe-S_N FAD_binding_3 Lycopene_cycl NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AGV47322
LinkDB All DBs
Position
444227..446062
Genome map
AA seq 611 aa AA seqDB search
MGEFSRRDFIKTACISVGALAASSSGVYALDDSSKMDKDINLPSCDVLVIGSGGAGLCAA
AAVRKENPKLSVVVATKMMPSRNATCMAEGGINGVTDFSNGDSYKLHAYDTIKGGAYLVD
QDAALKFCELAGKAIFNMDFIGTLFSRNEQGGVAQRLMGGASKKRCNYSADKTGHILMHS
CLDDAISSGVKFLMNHELLDIGVVDGKCEGVVLRDIQSGGIYPVLCKALVIATGGYTRIF
YNRTSTPFIATGDGVAAALRAGLGFEDPEMIQFHPTGVANGGTLITEAARGEGGYLLNNR
GERFMKNYHEKMELAPRDVVARAIETEIREGRGYGEGLGAYVLCDVRHLGKEKILKDLPK
IRHTAMLFENIDLVDTPVPIRPTAHYSMGGIEVAKFEDMGTKIAGIYVGGEASCISIHGA
NRLGGNSLADAVVTGHLAGIGATNYAKDASFGKGAKTHELAQKWQVRFKEITNNGGNGQE
MYELREELGSQNWDNMGIFRTQEKLDLLAKKLEDIQARYEKIRIPNPNEVMNTAFTDYVE
LGNLILLSRCACLAARNRLESRGAHTREDYPKRDDKNFLKHSIVNLENDELKLSYKDVVV
TEFSLDGRRVQ
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaattttctagaagagattttataaaaacagcctgtattagtgtaggagcttta
gctgcaagttcaagtggagtttatgctttagatgattcatctaagatggataaagatata
aatttaccttcttgcgatgttttggtaattggatcaggtggagcaggtttgtgtgctgca
gccgcagtgagaaaagaaaatccaaaattaagcgttgtagtagctacaaagatgatgcca
tcgcgtaacgcaacttgtatggcagagggtggaattaatggagttactgatttttctaat
ggagattcctataaattacatgcttatgatactattaaaggcggagcttatttggtagat
caagatgcggctttaaaattttgcgaattagctggaaaggctatttttaatatggatttt
ataggaaccttgttttcaagaaatgagcaaggtggagtagctcagcgtttaatgggagga
gcttctaagaaacgctgtaactattctgcagataaaacaggtcatattttaatgcattct
tgtttagatgatgctattagtagtggtgtgaaatttttaatgaatcatgaacttttggat
ataggtgttgtggatggaaaatgcgagggtgtcgttttaagagatatacaaagcggtgga
atttatcctgtgttatgcaaagctttggtgattgctacagggggatacacaaggatattt
tataatagaacttcaactccttttattgccacaggagatggtgtggcagctgctcttaga
gcaggacttggttttgaagatcctgagatgatacaatttcacccaacaggagttgcaaat
ggtggaactcttattacagaagcggcgcgcggtgaagggggatatcttttaaataatcgt
ggtgagcgttttatgaaaaattaccatgaaaaaatggagcttgcaccgcgagatgtggtt
gcgcgtgctatagaaacagaaattcgtgaaggtagaggttatggcgagggacttggagct
tatgttttgtgcgatgtacgccacttaggaaaagaaaaaattttaaaagatttaccaaaa
attcgtcacactgcaatgctttttgaaaatattgatttagtagatactcctgtacctatc
cgtccaacggcgcattattctatgggtggaattgaagtggctaaatttgaagatatgggt
actaaaattgctggaatttatgtaggtggagaagcttcttgcatttctatacatggagct
aatagactagggggaaattctttagccgatgcagttgtaacagggcatttagcaggcatt
ggtgcgacaaattatgctaaagatgcaagttttggaaaaggggcaaaaactcatgaactt
gctcaaaaatggcaggttagatttaaagaaattacaaataatggcggaaatggtcaagaa
atgtatgaattgcgagaagagctaggaagtcaaaattgggataatatggggatttttaga
actcaagaaaaactcgatcttctagcaaaaaaattagaagatatacaagcgagatatgaa
aaaattcgtattccaaatcctaatgaagtgatgaatactgcttttacagattatgtagag
cttggtaatttgattttactttctcgctgtgcttgtttagcagctagaaatagacttgaa
agccgtggggctcatactagagaagattatccaaagcgagatgataaaaatttcttaaaa
catagcattgtaaatttagaaaatgatgaattaaaacttagttataaagatgtcgtggta
actgagttttcacttgatggaaggagagtacaatga

DBGET integrated database retrieval system