KEGG   Campylobacter jejuni subsp. jejuni 00-2544: N755_00468Help
Entry
N755_00468        CDS       T02843                                 

Definition
(GenBank) (2Fe-2S)-binding protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
cjen  Campylobacter jejuni subsp. jejuni 00-2544
Pathway
cjen00020  Citrate cycle (TCA cycle)
cjen00190  Oxidative phosphorylation
cjen00650  Butanoate metabolism
cjen01100  Metabolic pathways
cjen01110  Biosynthesis of secondary metabolites
cjen01120  Microbial metabolism in diverse environments
cjen01130  Biosynthesis of antibiotics
cjen01200  Carbon metabolism
Module
cjen_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cjen_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:cjen00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    N755_00468
   00650 Butanoate metabolism
    N755_00468
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    N755_00468
Enzymes [BR:cjen01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     N755_00468
    1.3.5.4  fumarate reductase (quinol)
     N755_00468
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_9 Fer4_8 Fer4_17 Fer2 Fer4_7 Fer4_10 Fer4_16 Fer4 Fer4_21
Motif
Other DBs
NCBI-ProteinID: AGV47323
LinkDB All DBs
Position
446059..447024
Genome map
AA seq 321 aa AA seqDB search
MKIIIDRFNGKEKYEQSYDIDDKDIQGKTLLSLLLFIKKTKDITLNFTASCQSAICGACA
VRVNGHSYLACDTKMQDLLKEYDNPSSIRISPLGNFRVISDLIVDWEPSIENLRKIRPAM
VAKNEFSAEKGCKQSQEEFDRISKQWDCILCGSCASECNKLEADSSDYMQPFVFTHVWRA
AADSRGKDPMLHVKPSVMNGLWLCVHCQECADRCPKGISSVSDIANLRVMAIKKGLNEGL
GPDHAEAFYKDLVEGSGRLNEIYLALRSEGVIGSMGKTDIAFKLMRAGKMNPMHVFGEGE
IEGYKDLVKMIKAAQEAAVKE
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattatcatagatcgttttaatggcaaggaaaaatatgaacaaagttatgatatt
gatgataaggatatacaaggaaaaactctgctctctcttttgctttttatcaaaaaaaca
aaagatattactttaaattttaccgcctcttgtcaatctgcaatttgtggggcttgtgca
gttcgtgtgaatgggcattcttatcttgcttgtgatactaaaatgcaagatttgttaaaa
gaatatgataatccttcaagtatacgcatttctccgcttggaaattttagagtaatttct
gatttaattgtggattgggaaccttctatagaaaatttaagaaaaattcgtcctgccatg
gtggcaaaaaatgaattttcagcggaaaagggctgtaaacaaagtcaagaagaatttgat
cgtattagcaagcaatgggattgtattttatgtggtagctgtgcttcagagtgtaataaa
ttagaagcagatagtagcgattatatgcaaccttttgtttttactcatgtttggcgtgca
gcggcggactctcgaggtaaggatcctatgttgcatgtaaaacccagcgtaatgaatgga
ctttggctttgtgttcattgtcaagagtgcgctgatcgttgtccaaagggtataagttca
gtaagtgatatagcaaatttaagagtgatggcgattaaaaaaggtttaaatgaaggctta
gggcctgatcatgctgaagctttttataaagatttagttgaaggttcaggacgcttgaat
gaaatttatcttgctttgcgttctgagggtgttataggttctatgggtaaaacagatata
gcttttaaacttatgcgtgcaggaaaaatgaatcctatgcatgtttttggcgagggtgaa
atagaagggtataaagatttggttaaaatgataaaggcggcacaagaagctgctgttaag
gagtaa

DBGET integrated database retrieval system