KEGG   Campylobacter jejuni subsp. jejuni 00-2544: N755_00542Help
Entry
N755_00542        CDS       T02843                                 

Definition
(GenBank) penicillin-binding protein
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
cjen  Campylobacter jejuni subsp. jejuni 00-2544
Pathway
cjen00550  Peptidoglycan biosynthesis
cjen01100  Metabolic pathways
cjen01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:cjen00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    N755_00542
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    N755_00542
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cjen01003]
    N755_00542
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cjen01011]
    N755_00542
Enzymes [BR:cjen01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     N755_00542
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     N755_00542
Glycosyltransferases [BR:cjen01003]
 Polysaccharide
  Bacterial polysaccharide
   N755_00542
Peptidoglycan biosynthesis and degradation proteins [BR:cjen01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   N755_00542
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase
Motif
Other DBs
NCBI-ProteinID: AGV47390
LinkDB All DBs
Position
511610..513541
Genome map
AA seq 643 aa AA seqDB search
MKILKYIFSFFTLLFITGFIYVAYLFTSADTEGYTFKEYKPPLTTQIYDRNGKLVANIFE
QHRFYAPYEELPPRLIEALVAIEDTSFFEHNGVNIDAIFRAAVKIIKSGGKTMEGASTLT
QQFIKNTELTPERTIARKIREALLAYKMETILTKEQILERYLNFIFFGHGYYGVKTAALG
YFHKNLNELSLKEIAMLVGMPKAPSSYDPTKHLDLSISRANNVISRMYNLGWISKADYDT
AIKEIPQVYDDTLTQNAAPYVVDEVIKQLSPNIKDLKTGGYKIILNIDLDVQNMAQNALK
FGYDEIVKRDKDANLSTLNGAMVVVNHQSGDVLALVGGVDYEKSNYNRATQSMRQPGSSF
KPFVYQVAINLGYSPMSEIADISRIFEGGAGNNEDWKPKNEGGKFLGLITLKEALTRSRN
LATINLALDMGLDVLYSKLMEFGFKDIPPNLSIVLGSFGISPLEYSKFYTMFGNYGTIKD
PQIIRQVQDKTGKTIMEFNSNERKVSDEAQSFLVLDMMRNVVEKGTGRNARVKDIEIAGK
TGTTNKSVDAWFCGLTPEIEAIIWYGNDNNKPMRYTEGGARTAAPVFREFLTQYIEKFPD
TTRKFSIPNGVYRGNYKGESAYYTTKSPLPKANMKFNESEIIF
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatattaaaatatattttttcattttttactcttttgtttataactggatttatt
tatgtggcttatcttttcacaagtgctgatactgagggttatacttttaaagaatacaaa
cctcctcttacaacacaaatttacgatagaaatggcaagcttgtggctaatatttttgaa
caacatcgtttttacgctccttatgaagagcttcctccacgccttatagaagctttggtt
gctatagaagatacaagcttttttgaacataatggagttaatatcgacgccatttttaga
gctgccgtaaaaattataaaaagtggtggaaaaaccatggaaggagcttccactcttact
cagcaatttattaaaaacacggaattaaccccagaaagaactattgcgcgtaaaattcga
gaagctttgcttgcttataaaatggaaaccattttaactaaggaacaaattttagaaagg
tatttaaattttatcttttttggacatgggtattatggagtaaaaaccgcagctttgggg
tattttcataaaaatttaaatgaactaagccttaaagagattgctatgctagtaggtatg
ccaaaagcacctagcagttatgatcctacaaagcatttagatctttccatctcaagagca
aataatgttatttcaagaatgtataatctaggttggatttcaaaagcagattatgataca
gccattaaagaaattccgcaagtttatgatgatacgcttactcaaaatgctgctccttat
gtcgtagatgaagtgattaaacaattaagccctaatatcaaagacttaaaaacaggtgga
tataaaatcattttaaatatagacttagatgttcaaaatatggcacagaatgctttaaaa
tttggttatgatgagatagtaaaacgcgataaagatgcaaatttaagcactttaaacgga
gctatggtcgtggtaaatcatcaaagtggtgatgttttagctttggtaggtggagttgat
tatgaaaaaagtaattataaccgcgctactcaaagtatgcgtcaacctggaagctctttt
aaaccttttgtgtatcaagtggcgattaatttaggatattcgcctatgagtgaaattgct
gatatttctagaatttttgaaggtggagcgggtaataatgaggattggaaacctaaaaat
gaagggggtaaatttttaggtttaattaccttaaaagaagctttaacaagatcaagaaat
ttagctaccattaatctcgcacttgatatggggcttgatgttctttactctaaactaatg
gaatttggatttaaagatataccgcctaatttatcaatcgtattgggaagttttggtatt
tctcctttggagtattcgaaattttataccatgtttgggaactatggtacgattaaagat
cctcaaattatcagacaagttcaggataaaactggtaaaaccatcatggaatttaactca
aatgagcgtaaagtcagcgatgaagcgcaaagttttctggttttagatatgatgagaaat
gttgttgaaaaaggcacagggcgtaatgcaagagtaaaagatatagaaatagcaggaaaa
acaggaacaacgaataaaagtgttgatgcttggttttgtggacttacgcctgaaatagaa
gcaatcatttggtatggaaatgataacaacaagcctatgcgttatacagaaggtggggct
agaacagctgctcctgtgtttagagaatttttaactcaatatatagaaaaattccctgat
acaactagaaaatttagcattcctaatggagtttatcgtggaaattataaaggagaaagt
gcttattataccaccaaatcaccattaccaaaagcaaatatgaaatttaatgaaagcgag
attatattttga

DBGET integrated database retrieval system