KEGG   Campylobacter jejuni subsp. jejuni 00-2544: N755_00558Help
Entry
N755_00558        CDS       T02843                                 

Definition
(GenBank) penicillin-binding protein
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
cjen  Campylobacter jejuni subsp. jejuni 00-2544
Pathway
cjen00550  Peptidoglycan biosynthesis
cjen01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:cjen00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    N755_00558
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    N755_00558
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cjen01011]
    N755_00558
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cjen03036]
    N755_00558
Enzymes [BR:cjen01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     N755_00558
Peptidoglycan biosynthesis and degradation proteins [BR:cjen01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   N755_00558
Chromosome and associated proteins [BR:cjen03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    N755_00558
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: AGV47406
LinkDB All DBs
Position
complement(526249..528057)
Genome map
AA seq 602 aa AA seqDB search
MQEYKKNRVSKVAFAYCMALLFMIIFISSTFFLTSKRHIPNTEKDQYALALRGSIITKDN
FTITSSKQIYRAEIDLRSINKDKFDLFLKLFQIYSGISNDQVADIKKRMQNQKKRSYNFV
LLQNLDSKQASYLKDLAKKLYIQGFFKAFTNNSGRVETRGLNIIEHEEDRIYMSKDSFTP
IIGYTKMILDPESGILKNIGVKGLEKYYDACLSPVQNEKIQGLKDIGGNIILNLNSLQQK
KINGCDLYLNLSLKLQKSIEKAIDQRNEDLKANEIIVGVMESKTGRILALASSRRYDPQN
RGKDLSVLNASAIEYGYEAGSVIKPFIFTTALRLGKIKMDEVINTYGGSYKLGRFTIKDD
HKMDKMTMEEVIRYSSNIGMIQIAKRLNNIEIVSGLKIFKFGEKSGIDLPYEQKGEIPNP
KRLRDIEKSVLSYGYGLKTTFIQLLAAYNVFNNDGFYITPRLAEKFYQNGRFTNLDDDVK
KEKILSSEAAKTMQNVLINVIEKGTGKKAITQGIIAGGKTGTARIAERQGYTSNRYNASF
FGFANDLNHAYTIGVLVRHPTKPYSYYAAQSALPMFKDVVDILINEEFLTPIQDNNQTST
NN
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaatataaaaaaaatagggtttcaaaagttgcctttgcctactgcatggcactt
ttgtttatgattatttttatcagctctactttttttcttacatcaaaacgtcatatacct
aacactgaaaaagatcaatacgctcttgctctaagaggatcgattataaccaaagataat
tttactatcacaagttctaaacaaatttatcgtgctgaaattgatcttagaagcattaac
aaagataaatttgatctatttttaaagctttttcaaatttatagtgggataagtaacgat
caagtagcagatattaaaaaaagaatgcaaaatcaaaaaaaacgctcttataattttgtt
cttttacaaaacttagactccaagcaagcaagctaccttaaagatcttgctaaaaaactt
tatatacaaggttttttcaaagcttttacaaataactcaggaagagttgaaacaagagga
ttaaatatcatcgaacatgaagaagatagaatttacatgtcaaaagattcttttactcct
attatcggttatactaaaatgatattagatccagaaagtggaattttaaaaaatatagga
gttaaaggtttagaaaaatactacgatgcatgtctaagccctgttcaaaatgaaaaaatt
caaggacttaaagatataggtggaaatattattttaaatctaaattcactacaacaaaaa
aagatcaatggttgtgatttatatttaaatctttctttaaaactgcaaaaaagtatagag
aaagctatagatcaaagaaatgaggatttaaaagccaatgaaatcatcgttggggtaatg
gaaagtaaaacaggaagaattttagctctagcaagctcaaggcgttatgacccacaaaat
cgcggaaaggatctatcagttcttaatgcaagcgctatagaatacggctatgaagcaggt
tctgttatcaaaccttttatctttacaacagccttaagacttggtaaaataaaaatggat
gaagtgattaatacttatggcggttcttacaagctaggacgtttcaccatcaaagacgat
cacaaaatggacaaaatgactatggaggaagttataagatattcttcaaatataggcatg
atacaaattgctaaaaggcttaacaatatagaaatcgtatcaggacttaaaatatttaaa
tttggcgaaaaaagtggtattgatctaccctatgaacaaaaaggagaaattccaaatcct
aagcgcttaagagatatagaaaaatctgttttaagttatggttatggacttaaaacaacc
tttatacaactccttgcagcttataatgttttcaacaatgatgggttttatatcacacca
cgtttagctgaaaaattctatcaaaatggacgctttacaaatcttgatgatgatgtaaaa
aaagaaaaaattctttctagcgaagccgctaaaacgatgcaaaatgttcttataaatgtt
atagaaaaaggaacaggaaaaaaggcaattacacaaggtattattgcaggaggtaaaaca
ggaacggcaagaatagccgaaagacaaggttacacctcaaatcgctacaatgcatccttt
tttggttttgcaaatgatttaaatcacgcctataccataggagttctcgtaagacatcct
actaaaccttatagttattatgctgcacaaagtgctttgcctatgtttaaagatgttgtt
gatattttaatcaatgaagaatttctaacgcctatacaagacaataaccaaactagcaca
aacaactag

DBGET integrated database retrieval system