KEGG   Campylobacter jejuni subsp. jejuni 00-2544: N755_00728Help
Entry
N755_00728        CDS       T02843                                 

Definition
(GenBank) protease
  KO
K08303  putative protease [EC:3.4.-.-]
Organism
cjen  Campylobacter jejuni subsp. jejuni 00-2544
Brite
KEGG Orthology (KO) [BR:cjen00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cjen01002]
    N755_00728
Enzymes [BR:cjen01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     N755_00728
Peptidases and inhibitors [BR:cjen01002]
 Peptidases of unknown catalytic type
  Family U32
   N755_00728
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_U32 THF_DHG_CYH
Motif
Other DBs
NCBI-ProteinID: AGV47574
LinkDB All DBs
Position
699969..701222
Genome map
AA seq 417 aa AA seqDB search
MIIPEIVAPAGNFTKLKIALAYGADAVYAGVNNFSLRSRTAREFNYESFEEAIKYTHERG
KKIYVTLNGFHLSSQIEGLKRHILKLREMKPDAFIVASVGAMRLVKELAPEISLHVSTQA
NILNYLDAQVYKDMGAKRVVIARELGLKDAKALKENCDIELEAFVHGSMCFAYSGRCLIS
SVQSGRMSNRGSCANDCRFNYELYAKNPENGTLFRLEEDENGTHIFNSKDLNLCSYIEKI
MQENCISAFKIEGRTKSEYYVALTTRTYKMAIQDALEGKFESSKYEKEIATLKNRGFTDG
YLVSRPLEKTDTQNHNTSIEEGSHQVHAISEDGRFFKCKGKIVLNTPYEILTPLGDVIQT
CDNELGKIYQKEGKYFIEFKKLIAKNNKEFSEIHSGNEHEIQLPNKISALSFLRKEI
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgatcattcctgaaatagtagctcctgcaggaaatttcacaaaattaaaaattgcttta
gcttatggcgcagatgcggtttatgcgggtgtgaataatttttctttaagatcacgcact
gcaagagaatttaattatgaaagttttgaagaagctatcaaatatactcatgagcgtggt
aagaaaatttatgttactttaaatggttttcatttgagttctcaaattgaaggtttaaaa
agacatattttaaaattgcgtgagatgaaacctgatgcttttattgtagcttctgttgga
gctatgcgtcttgttaaagaacttgcacctgaaatttctttacatgtttctactcaggca
aatattttaaattatttagatgctcaagtttataaggatatgggtgctaaaagggttgta
attgccagagaattagggcttaaagacgctaaagctttaaaggaaaattgcgatattgaa
cttgaagcttttgtgcatggttctatgtgttttgcttattcagggcgttgtttaataagc
tctgtgcaaagtggaagaatgagcaatcgtggatcttgtgcaaatgattgtagatttaat
tatgagctttatgctaaaaatccagaaaatggcactttatttcgcttagaagaagatgaa
aatggtactcatatttttaattctaaagatttaaatctttgttcttatatagaaaaaatc
atgcaagaaaattgtatcagtgcttttaaaatagaagggcgtactaaaagcgaatattat
gttgcgcttacaacaaggacttataaaatggccatacaagatgctttagagggtaaattt
gagtcaagtaagtatgaaaaagagattgctacacttaaaaatcgtggttttacagatggc
tatcttgtttcgcgtcctttagaaaaaaccgacacacaaaatcataatacaagcatagaa
gaaggttctcatcaagtgcatgctataagcgaagatggaagattttttaaatgtaaaggg
aaaatcgttttaaacacgccttatgaaattttaacccctttaggcgatgtgattcaaact
tgcgataatgaactaggtaaaatttatcaaaaagagggtaaatattttatagagtttaaa
aaacttattgctaaaaacaataaagaatttagcgaaattcatagcggtaatgaacatgaa
atccaattaccaaataaaatcagtgcattaagttttttaagaaaggaaatatag

DBGET integrated database retrieval system