KEGG   Campylobacter jejuni subsp. jejuni 00-2544: N755_00972Help
Entry
N755_00972        CDS       T02843                                 

Definition
(GenBank) phage SPO1 DNA polymerase-related protein
  KO
K21929  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
cjen  Campylobacter jejuni subsp. jejuni 00-2544
Pathway
cjen03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:cjen00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    N755_00972
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cjen03400]
    N755_00972
Enzymes [BR:cjen01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     N755_00972
DNA repair and recombination proteins [BR:cjen03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     N755_00972
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG DUF5503
Motif
Other DBs
NCBI-ProteinID: AGV47813
LinkDB All DBs
Position
942060..942668
Genome map
AA seq 202 aa AA seqDB search
MIRSLYYLKAMGFNFVDTHTNHFEQVQNFQELKQLVSSCTLCQFSKTRKFSLMEPKIKNA
KLLILDVFGQKSENESGILLNSKKGEKLKHYIYQILGLCDEDFYFSYLFKCFCNGKFDDF
SLQSCLPFFWNELKLIQPAFLLCLGEYTFKSLGFKDYHILKGEVFAYKNFFIMPSYDLDF
IEKNPSYEKNFIQDLKKIKGFL
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgataagaagtctttattatttaaaagctatgggatttaactttgttgatacacataca
aaccactttgaacaagtacaaaattttcaagaattaaaacaacttgtttcatcttgcacc
ttatgccaattttccaaaacaagaaaatttagtcttatggagcctaagataaaaaatgcc
aaattgctaattcttgatgtttttgggcaaaagagtgaaaatgaaagcggaattttactt
aattcaaaaaaaggtgaaaaattaaaacactatatttatcaaattttagggctttgcgat
gaagatttttatttttcttatttatttaaatgtttttgtaatggaaaatttgatgatttt
tcgctacaatcttgcttaccatttttctggaacgaactaaaactgattcaacctgctttt
ttactttgtctaggagaatatacatttaaaagcttgggatttaaagattatcacatttta
aaaggtgaagtttttgcttataaaaattttttcataatgccaagttatgatttagatttt
atagaaaaaaatccaagttatgaaaaaaattttatacaagatttaaaaaaaattaaagga
tttttatga

DBGET integrated database retrieval system