KEGG   Campylobacter jejuni subsp. jejuni R14: H730_06580Help
Entry
H730_06580        CDS       T03187                                 

Definition
(GenBank) UDP-4-keto-6-deoxy-GlcNAc C4 aminotransferase
  KO
K15910  UDP-N-acetylbacillosamine transaminase [EC:2.6.1.34]
Organism
cjer  Campylobacter jejuni subsp. jejuni R14
Pathway
cjer00520  Amino sugar and nucleotide sugar metabolism
cjer01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cjer00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    H730_06580
Enzymes [BR:cjer01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.34  UDP-N-acetylbacillosamine transaminase
     H730_06580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DegT_DnrJ_EryC1 Aminotran_5 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AHW92159
LinkDB All DBs
Structure
PDB: 

Position
complement(1168747..1169907)
Genome map
AA seq 386 aa AA seqDB search
MRFFLSPPHMGGNELKYIEEVFKSNYIAPLGEFVNRFEQSVKAYSKSENALALNSATAAL
HLALRVAGVKQDDIVLASSFTFIASVAPICYLKAKPVFIDCDETYNIDVDLLKLAIKECE
KKPKALILTHLYGNAAKMDEIVEICKENEIVLIEDAAEALGSFYKNKALGTFGEFGAYSY
NGNKIITTSGGGMLIGKNKEKIEKARFYSTQARENCLHYEHLDYGYNYRLSNVLGAIGVA
QMEVLEQRVLKKREIYEWYKEFLGECFSFLDELENSRSNRWLSTALIDFDKNELNSCQKD
INISQKNITLHPKISKLIEDLKNEQIETRPLWKAMHAQEVFKGAKAYLNGNSELFFQKGI
CLPSGTAMSKDDVYEISKLILKSIKA
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgagattttttctttctcctccgcatatgggtggtaatgaattaaaatatatagaagaa
gttttcaaaagcaattatatagcacctttgggtgaatttgtaaatcgctttgaacaaagt
gtcaaggcttacagtaaaagtgaaaatgccttagctttaaattcagccacagcggctttg
catttagctttaagggtggcaggggtaaaacaagatgatattgttttggcttcttctttt
acttttatcgcttcagtagcacctatttgttatcttaaagcaaaacctgtatttatagat
tgtgatgaaacttataatatcgatgtagatttattaaagcttgctattaaagaatgtgaa
aaaaaaccaaaagcattgattttaactcatctttatggcaatgcggctaaaatggatgaa
attgttgaaatttgcaaagaaaatgaaattgttttaatcgaagatgctgctgaagcttta
ggaagtttttataagaataaagctttaggaacttttggagaatttggagcttattcttat
aatggcaataaaattatcaccacttcaggtggaggtatgcttataggaaaaaataaagaa
aagattgaaaaagcaagattttatagcactcaagctagggaaaattgtttgcattatgaa
catttagattatggttataattaccgcttaagcaatgttttaggagctattggcgtagca
caaatggaggttttagaacaaagagtgcttaaaaaaagagaaatttatgagtggtataaa
gaatttttaggagagtgttttagctttttagatgaattagaaaattcaagaagcaatcgc
tggttaagtacagctttgattgattttgataaaaatgaacttaattcttgtcaaaaagat
ataaatatcagtcaaaaaaatattactttgcatccaaaaatttcaaaactcatagaagat
ttgaaaaatgaacaaatagaaacaagaccattatggaaagctatgcacgctcaagaagta
tttaaaggagctaaggcttatcttaatggcaatagtgagttatttttccaaaaaggaatt
tgtttgccaagtggcacggcgatgagtaaagatgatgtttatgaaatttcaaaactgatc
ttaaagagcataaaggcttaa

DBGET integrated database retrieval system