KEGG   Campylobacter jejuni subsp. jejuni 00-2538: N565_01132Help
Entry
N565_01132        CDS       T02842                                 

Definition
(GenBank) aminotransferase DegT
  KO
K15910  UDP-N-acetylbacillosamine transaminase [EC:2.6.1.34]
Organism
cjeu  Campylobacter jejuni subsp. jejuni 00-2538
Pathway
cjeu00520  Amino sugar and nucleotide sugar metabolism
cjeu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cjeu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    N565_01132
Enzymes [BR:cjeu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.34  UDP-N-acetylbacillosamine transaminase
     N565_01132
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DegT_DnrJ_EryC1 Aminotran_5 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AGV49727
LinkDB All DBs
Structure
PDB: 

Position
complement(1095769..1096929)
Genome map
AA seq 386 aa AA seqDB search
MRFFLSPPHMGGNELKYIEEVFKSNYIAPLGEFVNRFEQSVKAYSKSENALALNSATAAL
HLALRVAGVKQDDIVLASSFTFIASVAPICYLKAKPVFIDCDETYNIDVDLLKLAIKECE
KKPKALILTHLYGNAAKMDEIVEICKENEIVLIEDAAEALGSFYKNKALGTFGEFGAYSY
NGNKIITTSGGGMLIGKNKEKIEKARFYSTQARENCLHYEHLDYGYNYRLSNVLGAIGVA
QMEVLEQRVLKKREIYEWYKEFLGECFSFLDELENSRSNRWLSTALIDFDKNELNSCQKD
INISQKNITLHPKISKLIEDLKNEQIETRPLWKAMHAQEVFKGAKAYLNGNSELFFQKGI
CLPSGTAMSKDDVYEISKLILKSIKA
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgagattttttctttctcctccgcatatgggtggtaatgaattaaaatacatagaagaa
gttttcaaaagcaattatatagcacctttgggtgaatttgtaaatcgctttgaacaaagt
gtcaaggcttacagtaaaagtgaaaatgccttagctttaaattcagccacagcggctttg
catttagctttaagggtggcaggggtaaaacaagatgatattgttttggcttcttctttt
acttttatcgcttcagtagcacctatttgttatcttaaagcaaaacctgtatttatagat
tgtgatgaaacttataatatcgatgtagatttattaaagcttgctattaaagaatgtgaa
aaaaaaccaaaagcattgattttaactcatctttatggcaatgcggctaaaatggatgaa
attgttgaaatttgcaaagaaaatgaaattgttttaatcgaagatgctgctgaagcttta
ggaagtttttataagaataaagctttaggaacttttggagaatttggagcttattcttat
aatggcaataaaattatcaccacttcaggtggaggtatgcttataggaaaaaataaagaa
aagattgaaaaagcaagattttatagcactcaagctagggaaaattgtttgcattatgaa
catttagattatggttataattaccgcttaagcaatgttttaggagctattggcgtagcg
caaatggaggttttagaacaaagagtgcttaaaaaaagagaaatttatgagtggtataaa
gaatttttaggagagtgttttagctttttagatgaattagaaaattcaagaagcaatcgc
tggttaagtacagctttgattgattttgataaaaatgaacttaattcttgtcaaaaagat
ataaatatcagtcaaaaaaatattactttgcatccaaaaatttcaaaactcatagaagat
ttgaaaaatgaacaaatagaaacaagaccattatggaaagctatgcacgctcaagaagta
tttaaaggagctaaggcttatcttaatggcaatagtgagttatttttccaaaaaggaatt
tgtttgccaagtggcacggcgatgagtaaagatgatgtttatgaaatttcaaaactgatc
ttaaagagcataaaggcttaa

DBGET integrated database retrieval system