KEGG   Campylobacter jejuni subsp. jejuni IA3902: CJSA_0001Help
Entry
CJSA_0001         CDS       T01854                                 

Gene name
dnaA
Definition
(GenBank) chromosomal replication initiator protein DnaA
  KO
K02313  chromosomal replication initiator protein
Organism
cji  Campylobacter jejuni subsp. jejuni IA3902
Pathway
cji02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cji00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CJSA_0001 (dnaA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cji03032]
    CJSA_0001 (dnaA)
   03036 Chromosome and associated proteins [BR:cji03036]
    CJSA_0001 (dnaA)
DNA replication proteins [BR:cji03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    CJSA_0001 (dnaA)
Chromosome and associated proteins [BR:cji03036]
 Prokaryotic type
  Nucleoid associated proteins
   Other nucreoid associated proteins
    CJSA_0001 (dnaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_DnaA Bac_DnaA_C IstB_IS21 DnaA_N AAA ATPase_2 AAA_14 RNA_helicase AAA_22 AAA_24 Kinesin RuvB_N AAA_21 AAA_16
Motif
Other DBs
NCBI-ProteinID: ADC27656
LinkDB All DBs
Position
1..1323
Genome map
AA seq 440 aa AA seqDB search
MNPSQILENLKKELNENEYENYLSNLKFNEKQSKADLLVFNAPNELMAKFIQTKYGKKIA
HFYEVQSGNKAIINIQAQSAKQSNKSTKIDIAHIKAQSTILNPSFTFESFVVGDSNKYAY
GACKAIAHKDKLGKLYNPIFVYGPTGLGKTHLLQAVGNASLEMGKKVIYATSENFINDFT
SNLKNGSLDKFHEKYRNCDVLLIDDVQFLGKTDKIQEEFFFIFNEIKNNDGQIIMTSDNP
PNMLKGITERLKSRFAHGIIADITPPQLDTKIAIIRKKCEFNDINLSNDIINYIATSLGD
NIREIEGIIISLNAYATILGQEITLELAKSVMKDHIKEKKENITIDDILSLVCKEFNIKP
SDVKSNKKTQNIVTARRIVIYLARALTALTMPQLANYFEMKDHTAISHNVKKITEMIEND
GSLKAKIEELKNKILVKSQS
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgaatccaagccaaatacttgaaaatttaaaaaaagaattaaacgaaaacgaatacgaa
aactatttatcaaatttaaaattcaacgaaaaacaaagcaaagcagatcttttagttttt
aatgctccaaatgaactcatggctaaattcatacaaacaaaatacggcaaaaaaatcgcg
catttttatgaagtgcaaagcggaaataaagccatcataaacatacaagcacaaagtgct
aaacaaagcaacaaaagcacaaaaatcgacatagctcatataaaggcacaaagcacgatt
ttaaatccttcttttacttttgaaagttttgttgtaggggattctaacaaatacgcttat
ggagcatgtaaagccatagcacataaagacaagcttggaaaactttataatcctatcttt
gtttatgggcctacaggacttggaaaaacacatttacttcaagcagttggaaatgcaagc
ttagaaatgggaaaaaaagttatttacgctaccagtgaaaattttatcaatgattttact
tcaaatttaaaaaatggctctttagataaatttcatgaaaagtatagaaactgcgatgtt
ttgcttatagatgatgtgcagtttttaggaaaaaccgataaaattcaagaagaatttttc
tttatatttaatgaaatcaaaaataacgatggacaaatcatcatgacttcagacaatcca
cccaacatgctaaaaggtataaccgaacgcttaaaaagtcgttttgcacatgggatcata
gctgatataactccacctcaactagatacaaaaatagccatcataagaaaaaaatgtgaa
tttaacgatatcaatctttctaatgatatcataaactatatcgccacttctttaggggat
aatataagagaaatagaaggtatcatcataagtttaaatgcttatgcaaccatactagga
caagaaatcacactcgaacttgccaaaagtgtgatgaaagatcatatcaaagaaaagaaa
gaaaatatcactatagatgacattttatctttggtatgtaaagaatttaacatcaaacca
agcgatgtgaaatccaataaaaaaactcaaaatatagtcacagcaagacgcattgtgatt
tacctagctagggcacttacggctttgactatgccacaacttgcgaattattttgaaatg
aaagatcatacagctatttcacataatgttaaaaaaatcacagaaatgatagaaaatgat
ggttctttaaaagcaaaaatcgaagaacttaaaaacaaaattcttgttaaaagtcaaagt
taa

DBGET integrated database retrieval system