KEGG   Corynebacterium jeikeium: jk0154Help
Entry
jk0154            CDS       T00255                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
cjk  Corynebacterium jeikeium
Brite
KEGG Orthology (KO) [BR:cjk00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    jk0154 (ahpF)
Enzymes [BR:cjk01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     jk0154 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 GIDA K_oxygenase HI0933_like Glutaredoxin Thioredoxin_4 Thi4 FAD_oxidored DUF2156
Motif
Other DBs
NCBI-ProteinID: CAI36306
UniProt: Q4JY01
LinkDB All DBs
Position
complement(189430..191010)
Genome map
AA seq 526 aa AA seqDB search
MAKQLLDDNLRKQLGQLVPRITKDIELVYSLDERSASEDLEKLLQDIAELSDKITARRDD
DAHERKPSFSIVRTGSDISVAFAGIPMGHEFSSLVLALLQVGGNPIKEDKDLIEQVENLD
GDYEFVTYMSLTCQNCPTVVQALNTMAVLNPRIKHTAVEGSLFQDEVNENNVLAVPTIYL
NGEEFGQGRTTIEDFVRKLDSGSAAREAKKLNEKDAYEVLVVGQGPAGAAASIYVARKGL
SVGLIGERFGGQVLDTNSIENFISVPSTEGPKLAAEFEEHVGQYDIDVVKAQAATGLTPA
TEEGGLHTVHFGDDATLRARALVIATGAQWRTLGVPGEEEYRNKGVTFCPHCDGPLFKGK
SVAVIGGGNSGIEAALDLAGVVKHVTVLEFGEACRADDILMQRVEETANIDVITSAATTE
IVGDGKNVTGLNYTDRTNDESKSLDVAGVFIQIGLVPNTQWLGESGLELNKMGEIVVDEH
NATNVPGVYAAGDCTAVPFKQIVIAQGAGANAALGAWQYTVTAPKA
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atggctaagcaattactggacgacaacctgcgcaagcagctcggtcagctcgtcccccgc
attaccaaggacattgagctggtctacagcctggacgagcgttcggcctccgaggacctg
gagaagctgctgcaggacatcgccgagctgtccgacaagatcactgcccgccgcgatgac
gacgcgcacgagcgcaagccctccttcagcatcgtccgcaccggcagcgacatttcggtg
gccttcgcgggcatcccgatggggcacgagttcagctccctggtgctggcactgctgcag
gtcggcggcaacccgatcaaggaagacaaggacctgatcgagcaggtagaaaacctggac
ggcgactacgagttcgtcacctacatgtccctgacctgccagaactgcccgaccgtcgtg
caggcgctgaacaccatggcggtgctgaacccacgcatcaagcacaccgcggtggagggc
tcgctgttccaggacgaggtcaacgagaacaacgttctggccgtgccaaccatctaccta
aacggcgaggagttcggtcagggccgcaccaccatcgaggacttcgtgcgcaagctggac
agcggttccgcagcgcgtgaggcgaagaagctcaatgaaaaggacgcctacgaggtgctg
gtcgttggccagggaccggcgggcgctgcggcctccatctacgttgcccgcaagggtctg
agcgtcggcctgatcggcgagcgcttcggcggccaggtgctggacacgaactccatcgag
aatttcatctccgtgccctccaccgagggcccgaagctggcggcggagttcgaggagcac
gtcggccagtacgacattgacgtggtgaaggcccaggccgcgacgggtctgacccctgct
accgaggagggtggcctgcacacggtgcactttggggatgacgccaccctgcgcgcccgt
gccctggtaatcgccacgggcgcacagtggcgaaccctgggcgttccaggcgaggaagag
taccgcaacaagggcgtgaccttctgcccgcactgcgacggcccgctgttcaaggggaag
tccgtggctgtgatcggcggcggaaactcgggcatcgaggctgcgctggaccttgccgga
gtggtgaagcacgtgacggttctggagttcggcgaggcctgccgcgcggatgacatcctg
atgcagcgcgtggaggaaaccgcgaacatcgacgtgattacgtcggcagctactacggaa
atcgttggcgacggcaagaacgtcaccggcctgaactacacggaccgcactaacgacgag
tcgaagtctctggacgtcgcgggcgtgttcatccagatcggcctggtgccgaatacccag
tggctgggcgagagtggcctggaactgaacaagatgggcgagatcgtagtggatgaacac
aacgccaccaacgtccctggcgtgtacgccgccggagactgcactgcagtgccgttcaag
cagattgtgattgcccagggcgccggcgcaaacgctgcgctgggtgcgtggcagtacacg
gtgactgcgccgaaggcgtag

DBGET integrated database retrieval system