KEGG   Corynebacterium jeikeium: jk0175Help
Entry
jk0175            CDS       T00255                                 

Gene name
aspC
Definition
(GenBank) aspartate aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
cjk  Corynebacterium jeikeium
Pathway
cjk00220  Arginine biosynthesis
cjk00250  Alanine, aspartate and glutamate metabolism
cjk00290  Valine, leucine and isoleucine biosynthesis
cjk01100  Metabolic pathways
cjk01110  Biosynthesis of secondary metabolites
cjk01130  Biosynthesis of antibiotics
cjk01210  2-Oxocarboxylic acid metabolism
cjk01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cjk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    jk0175 (aspC)
   00290 Valine, leucine and isoleucine biosynthesis
    jk0175 (aspC)
   00220 Arginine biosynthesis
    jk0175 (aspC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cjk01007]
    jk0175 (aspC)
Enzymes [BR:cjk01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     jk0175 (aspC)
    2.6.1.66  valine---pyruvate transaminase
     jk0175 (aspC)
Amino acid related enzymes [BR:cjk01007]
 Aminotransferase (transaminase)
  Class I
   jk0175 (aspC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: CAI36327
UniProt: Q4JXY0
LinkDB All DBs
Position
complement(218056..219300)
Genome map
AA seq 414 aa AA seqDB search
MSTPKRPSELRTLDQSTKLQNVLYEIRGPVNTEAERMEADGHRILKLNTGNPAVFGFEAP
DVIMRDMIAALPTAQGYSTSKGIISARRAIVSRYEVIPGFPQFDVEDVYLGNGVSELITM
TMQALLNDGDEVLIPSPDYPLWTASTSLSGGRPVHYLCDEENDWMPSIEDIKAKVTERTK
AIVVINPNNPTGAVYSREILQQIVDVAREHSLLILADEIYDKILYDDAQHINIASLCPDL
LCITYNGLSKAYRVAGYRSGWMVVTGPKGHAKGFIEGVNVLAGTRLCPNVPAQHAIQVAI
SGRQSIDDLVLPGGRLLEQRNAAYEALNEIPGVSCVKPMGALYAFPRLDPNVHEIHDDEQ
FMFDLLRSEKIHLVQGTGFNWPTPDHFRVVTLPWARDLRAAIERLGNFLASYRQ
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgagtacccccaaacgcccaagcgaactgcgcacgctggatcaatcgacgaagctgcaa
aacgtcctctacgaaattcgcggcccggtgaacaccgaggcggagcggatggaggccgac
gggcaccgcatcctgaagctcaacacgggcaaccccgcggtgttcggcttcgaggcgccg
gatgtgatcatgcgggacatgatcgccgcgctgccgacggcgcagggctactccacgtcg
aagggcatcatcagcgcccgccgcgcaatcgtctcccgctacgaggtcatccccggcttc
cctcagttcgacgtcgaagatgtctacctcggcaacggtgtatccgagctgatcaccatg
acgatgcaggcgctgctcaacgatggcgacgaggtgctgatcccctccccggactacccg
ctgtggactgcctccacctccctgtccggcggtcgccccgtgcactacctgtgcgatgag
gagaacgactggatgccctccatcgaggacatcaaggcgaaggtcacggagcgcaccaag
gccatcgtggtcattaacccgaataacccgacaggcgcggtgtactcccgcgagatcctg
cagcagatcgtcgacgtcgcccgcgagcactccctgctgatcctggccgacgagatttac
gacaagatcctgtacgacgacgcccagcacatcaacattgcttccctgtgcccggacctg
ctgtgcatcacctacaacggcctgtcgaaggcgtaccgcgtggcgggttatcgttccggc
tggatggtggttactggcccgaaggggcatgcaaagggattcatcgagggtgtgaatgtg
ctggcgggcacgcgcctgtgcccgaatgtgccggcgcagcatgcgatccaggtggctatt
tccggccgccagtccatcgacgatctagtgctgccgggtgggcgcctgctggagcagcgc
aacgccgcctacgaggcgctgaatgagatcccgggtgtgagctgcgtgaagccgatgggt
gcgctgtatgccttcccgcgcctggacccgaacgtgcacgagatccacgacgacgagcag
ttcatgttcgatctgctgcgctcggagaagattcacctggtgcagggcacgggctttaac
tggccgaccccggaccacttccgcgtggtcacgctgccgtgggcccgcgatctgcgcgcc
gcgatcgagcgcttgggtaacttcctggctagctaccggcagtag

DBGET integrated database retrieval system