KEGG   Corynebacterium jeikeium: jk0687Help
Entry
jk0687            CDS       T00255                                 

Definition
(GenBank) putative membrane protein
  KO
K01421  putative membrane protein
Organism
cjk  Corynebacterium jeikeium
Brite
KEGG Orthology (KO) [BR:cjk00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    jk0687
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC2_membrane_3 DUF3533 ABC2_membrane ATG16 DUF948 OppC_N
Motif
Other DBs
NCBI-ProteinID: CAI36849
UniProt: Q4JWF8
LinkDB All DBs
Position
complement(825524..827656)
Genome map
AA seq 710 aa AA seqDB search
MLAGFKLNSEIRSFKRNKLTRAALVILVLMPLLYSALYLWAFWNPFGNLNSLPVALVNSD
KGTNVDGKELRAGDQVIQGLKDNDQISWIETDAEDARKGVESGQYYFSLELPENFSEAVA
SPTSDSPEKANLISTYNDANGYLSTMIGQNVMREVVSVVGDKISAEAVDKVLVGIVDAGS
GMQKAAIGAGKLADGTAELKDGSIQLDDGANKLADGLATAKDGSGKLRKGATDLDDGLVK
LHDGSGKLADGTDELATKVNAAADKINGKAGKLNELEDGVNKLGDGASRVNDGVQKLNTQ
LGGVTKVQGDHAANLRGLSRDLRGTGVPAAITAADELDKVALSLETQGLGPKSQNASDLK
RLADGSAQLSYQLNDPNAPLRNGVTELKGLPGQFKQLQDGVNKLNDGAQTLDEKMGEASD
GAGKLKDGVIKLDDGNTKLKDGADKLVEGTGKAKDGTAKLNDGASELHTKLSDGAKQVPK
WNEGQRLATASTIGGPVDLKSDNDSGTHTFGAGMAPFFFSMALFIGGIMVYVMIKPLQAR
TVNSGVHSWRAALSGFLPTGLLAIGQAAVVVGVTVWGVGMDVDNLPGLFLFAALVALVWM
LMNQMFIAFMGPGPGRVAALAVLMLMIVASGGLYPVETQNKFFQFLHPFDPMTYTVNGFR
QLIYGFYDERLPIAVGVLALVGLGCFLVTTLSARSQQTWTMKRLHPVLNA
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atgcttgccggtttcaaactcaacagcgaaatccgcagcttcaagcgcaataagctcact
cgagccgcacttgtcatccttgtgctcatgccgctgctgtactccgccctctacctgtgg
gcattctggaaccccttcgggaacctgaacagtctgcctgtcgcactggttaacagtgac
aagggaaccaacgttgacggcaaggaactgcgcgccggcgaccaggtgattcaggggcta
aaggataacgaccagatcagctggatcgaaacggatgccgaagatgcccgcaagggcgtg
gaatccggccagtactacttctccctcgaactgccggaaaacttctccgaagcggtggct
tcccccacctccgacagcccagagaaggccaatctcatcagcacctacaacgacgcgaac
ggctacctgtccaccatgatcggccagaacgtcatgcgtgaggtcgtcagcgtggtgggc
gacaagatcagtgcagaggccgtggacaaggtcctcgtcggcatcgtggacgccggctcc
ggcatgcaaaaggccgccatcggcgccggcaagctcgcagacggcaccgctgaactgaag
gacgggtctatccaattggacgacggcgccaacaaactcgccgacggcctggccaccgcc
aaggacggctccggcaagctgcgcaagggcgcaaccgatctggacgacggactcgtcaag
ctccacgacggctcgggcaaactagccgacggtactgacgagctcgccacgaaggtgaac
gctgcggccgacaagatcaacggcaaggccggaaagctcaacgagctggaagatggcgtc
aataaactcggcgacggagcaagccgcgtcaacgacggagtgcagaagctcaacacccaa
ctcggtggcgtgaccaaggtccagggcgaccacgcggctaacctgcgtggactctcccgc
gacctgcgcggcaccggcgtgcccgccgccatcaccgcagccgacgagctggacaaggtc
gccctctccctggaaacgcagggcctcggcccgaagtcgcagaacgcatcggacttgaag
cgcctggccgacggcagcgcacagctgtcctaccagctcaacgacccgaacgcgccgcta
cgcaacggcgtgacagagctgaagggcctacctggacagttcaagcagctccaggatggc
gtgaacaagctcaacgacggcgcgcagacgctcgacgagaagatgggcgaagcctccgac
ggcgcgggcaagctgaaggacggcgtaatcaagctggacgacggcaacaccaagctcaag
gacggtgcggacaagctcgtcgaaggcaccggcaaggccaaggacggcaccgccaagctg
aacgacggcgcttccgagctgcacaccaagctctccgacggcgccaagcaggttccgaag
tggaacgaaggccagcgcctggccactgcctccaccatcggtggaccggtggacctgaag
agcgataacgattccggcacccacaccttcggcgccggcatggcaccgttcttcttcagt
atggcgctgttcatcggcggcatcatggtctacgtgatgatcaagccgctgcaggcccgc
accgtcaactccggcgtgcactcctggcgtgcggcgctctccggcttcctgccgaccggt
ctactcgccatcggtcaggcagcggtcgtggtcggcgtgaccgtatggggcgtgggcatg
gacgtcgataacctgccgggtctgttcctcttcgcagccctcgtggctctggtgtggatg
ctgatgaaccaaatgttcatcgcgttcatggggcctggaccaggccgcgtggccgcccta
gcggtgctcatgctcatgatcgtcgcctcgggaggcctctaccccgtcgagacccaaaac
aagttcttccaattcctgcatccgttcgacccaatgacgtacacggtcaacggcttcagg
cagctgatctacggcttctacgacgaacgcctaccgatcgcagtaggagtactcgccctc
gtcggactcggctgcttcctggtcaccacgctatcggcccgcagccagcaaacgtggacc
atgaagcgactgcacccggtgctgaacgcttaa

DBGET integrated database retrieval system