KEGG   Campylobacter jejuni subsp. jejuni 00-1597: PJ17_01340Help
Entry
PJ17_01340        CDS       T03791                                 

Definition
(GenBank) 3-hydroxyacyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
cjl  Campylobacter jejuni subsp. jejuni 00-1597
Pathway
cjl00061  Fatty acid biosynthesis
cjl00780  Biotin metabolism
cjl01100  Metabolic pathways
cjl01212  Fatty acid metabolism
Module
cjl_M00083  Fatty acid biosynthesis, elongation
cjl_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:cjl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PJ17_01340
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    PJ17_01340
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cjl01004]
    PJ17_01340
Enzymes [BR:cjl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     PJ17_01340
Lipid biosynthesis proteins [BR:cjl01004]
 Fatty acid synthase
  Component type
   PJ17_01340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT 4HBT_2
Motif
Other DBs
NCBI-ProteinID: AJK70449
UniProt: A0A0E1ERE9
LinkDB All DBs
Structure
PDB: 

Position
255674..256114
Genome map
AA seq 146 aa AA seqDB search
MIDVMQIQEILPHRYPFLLVDKITELKVKEVVRGYKNISISDHVFMGHFPGHPIYPGVLI
LEGMAQTGGVLAFESMEDKVDPKSKVVYFTGIDGAKFRNPVRPGDRLDYEMSVVKNRGNM
WIFKGQAFVDGNLVAEAELKAMIVDK
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgatagatgtaatgcaaattcaagaaattttaccacaccgttatccttttttactagta
gataaaattacagaattaaaagttaaagaagtggtgcgaggatataaaaacatcagtata
agtgatcatgtttttatgggacattttccagggcatcctatttatcctggagttttgatt
ttagaaggtatggctcaaacaggtggagttttagcttttgaaagtatggaagataaagtg
gatccaaaaagtaaagtagtttatttcacaggcatagatggagcaaaatttagaaatcct
gtgcgtcctggagataggcttgattatgaaatgagcgtggttaaaaatcgtggtaatatg
tggatttttaaagggcaagcttttgtagatggaaatttagttgcagaggccgagcttaaa
gctatgatagtggataaataa

DBGET integrated database retrieval system