KEGG   Campylobacter jejuni subsp. jejuni 00-1597: PJ17_03400Help
Entry
PJ17_03400        CDS       T03791                                 

Definition
(GenBank) phosphoribosylaminoimidazole carboxylase
  KO
K01588  5-(carboxyamino)imidazole ribonucleotide mutase [EC:5.4.99.18]
Organism
cjl  Campylobacter jejuni subsp. jejuni 00-1597
Pathway
cjl00230  Purine metabolism
cjl01100  Metabolic pathways
cjl01110  Biosynthesis of secondary metabolites
cjl01130  Biosynthesis of antibiotics
Module
cjl_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:cjl00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    PJ17_03400
Enzymes [BR:cjl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.18  5-(carboxyamino)imidazole ribonucleotide mutase
     PJ17_03400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRC
Motif
Other DBs
NCBI-ProteinID: AJK70833
LinkDB All DBs
Position
653594..654088
Genome map
AA seq 164 aa AA seqDB search
MNFVSILMGSKSDYETMKESAKTLESFGVKYELIISSAHRSPKRTKEYIANAEEKGVKVF
IAAAGMAAHLAGAVAAYTTKPVLGVPMPGSNLASMDSLFSTVQMPSGIPVGTLAIGKAGA
INAAYLAMQILAIYDVDLAQKLKEDRLEKEKKLVSDSKEVEVLL
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgaattttgtttctattttaatgggaagcaagagtgattatgagactatgaaagaatct
gctaaaactttagaaagttttggtgtaaagtatgaacttatcatctcatcagctcatcgt
agtccaaaaagaacaaaagagtatattgcaaatgctgaagaaaaaggtgtgaaggttttt
atagcagcagctggaatggcagcgcatttagctggagctgttgcagcttatacaacaaaa
cctgttttaggagtgcctatgccaggaagtaatcttgcaagtatggattctttgttttct
acggtgcaaatgcctagtggaattcctgtaggaactttagctattggtaaggctggagca
atcaatgctgcttatttggctatgcaaattttagctatttatgatgttgatttagcacaa
aagcttaaagaagatcgtcttgaaaaagaaaaaaaacttgtatctgattcaaaagaagta
gaagttttattataa

DBGET integrated database retrieval system