KEGG   Campylobacter jejuni subsp. jejuni 00-1597: PJ17_06020Help
Entry
PJ17_06020        CDS       T03791                                 

Definition
(GenBank) highly acidic protein
Organism
cjl  Campylobacter jejuni subsp. jejuni 00-1597
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AJK71317
LinkDB All DBs
Position
complement(1165901..1167544)
Genome map
AA seq 547 aa AA seqDB search
MKILLLNENPVVSRLVSLSAKKMSYDFEELNAYSENLGNYDVIVVDSDTPAPLKILKEKC
DRLIFLAPRNQNVEDIDAQILQKPFLPTDFLNLLNNKDANKHTSIDLPMLSNDENPYADI
SLDLDNLNLDDLPDENSLDINSEGMEDLSFDDDAQDDNANKTLETQNLEHDNLEQETIKE
QTQEDAQTDLDLTLEDGESEKEDLSQEHTALDTEPSLDELDDKNDEDLEIKEDDKNEEIE
KQELLDDSKTNTLEMQEELSESQDDNSNKTLETQNLEHDNLEQETIKEQTQEDTQIDLDL
TLEDGESEKEDLSQEHTALDTEPSLDELDDKNDEDLEDNKELQANISDFDDLPEVEEQEK
EMDFDDLPEDAEFLGQAKYNEESEENLEEFAPVVEEDVQDEIDDFASNLSTQDQIKEELA
QLDELDYGIDSDNSSKVLEDFKDEPILDDKELGTNEEEVVVPNLNISDFDTLKESDIQEA
LGEEILEKNEEPIVSDVTKDDNSEEIVNELSQSIAGAITSSIKDDTLKAALKGMNMNINI
NISFKED
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattttacttttaaatgaaaaccctgtagtttcaagacttgtaagccttagtgct
aaaaaaatgtcttatgattttgaagaacttaatgcttatagtgaaaatttgggtaattat
gatgtgattgttgtagatagtgatactccagcacctttaaaaattcttaaagaaaaatgc
gatagattgatttttttagccccgcgaaatcaaaatgtagaagatatagatgcgcaaatt
ttacaaaaaccttttttacctacagattttttaaatttacttaataataaagatgcgaac
aagcatacatctattgatttgccaatgttaagcaatgatgaaaatccttatgctgatata
agcttggatttagataatttaaatttagatgatttgcctgatgaaaattctttagatata
aattcagagggaatggaagatttgagttttgatgatgatgctcaagatgataatgcaaac
aaaactttagaaactcaaaatttagaacatgacaatttagaacaagaaacaattaaagaa
cagactcaagaagacgctcaaactgatttagatttaactttagaagatggtgaaagcgaa
aaagaagacttaagccaagaacatacagctttggatactgagcctagtttagatgagcta
gatgataaaaatgatgaagatttagaaatcaaagaagatgataaaaatgaagaaatagaa
aagcaagaattattagacgattctaaaacaaatacattagaaatgcaagaagagcttagc
gaatctcaagatgataattcaaacaaaactttagaaactcaaaatttagaacatgacaat
ttagaacaagaaacaattaaagaacagactcaagaagacactcaaattgatttagattta
actttagaagatggcgaaagtgaaaaagaagacttaagccaagaacatacagctttggat
actgagcctagtttagatgagctagatgataaaaatgatgaagatttagaagataataaa
gaattacaagctaatataagcgattttgatgatcttcctgaggttgaagagcaagaaaaa
gaaatggattttgatgatcttcctgaggatgctgaatttttaggtcaagcaaaatataat
gaagaatcagaggaaaatttagaggagtttgctcctgttgtggaagaagatgttcaagat
gaaatagatgattttgcttcaaatttgagtactcaagatcaaatcaaagaagaactagct
caacttgatgagcttgattatggtattgatagtgacaatagtagcaaggtcttagaagat
tttaaagatgaaccaattttagacgataaagaattaggaacaaatgaagaggaagtggtt
gtgccaaatttaaatataagtgattttgatacattgaaagaaagtgatatacaagaagct
cttggagaggaaatcttagaaaaaaatgaagagcctatagtaagtgatgtaactaaagat
gataatagcgaagagatagttaatgagcttagccaaagcatagcaggagcgatcacttca
agtattaaagatgataccttaaaagctgctcttaagggtatgaatatgaatataaatata
aacattagttttaaagaggattga

DBGET integrated database retrieval system