KEGG   Campylobacter jejuni subsp. jejuni M1: CJM1_0116Help
Entry
CJM1_0116         CDS       T01855                                 

Gene name
mtnN
Definition
(GenBank) MTA/SAH nucleosidase
  KO
K18284  adenosylhomocysteine/aminodeoxyfutalosine nucleosidase [EC:3.2.2.9 3.2.2.30]
Organism
cjm  Campylobacter jejuni subsp. jejuni M1
Pathway
cjm00130  Ubiquinone and other terpenoid-quinone biosynthesis
cjm00270  Cysteine and methionine metabolism
cjm01100  Metabolic pathways
cjm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cjm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CJM1_0116 (mtnN)
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    CJM1_0116 (mtnN)
Enzymes [BR:cjm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.9  adenosylhomocysteine nucleosidase
     CJM1_0116 (mtnN)
    3.2.2.30  aminodeoxyfutalosine nucleosidase
     CJM1_0116 (mtnN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PNP_UDP_1
Motif
Other DBs
NCBI-ProteinID: ADN90344
LinkDB All DBs
Structure
PDB: 

Position
126211..126897
Genome map
AA seq 228 aa AA seqDB search
MKIAILGAMSEEITPLLETLKDYTKIEHANNTYYFAKYKNHELVLAYSKIGKVNSTLSAS
VMIEKFGAQVLLFTGVAGAFNPELEIGDLLYATKLAQYDLDITAFGHPLGFVPGNEIFIK
TDEKLNNLALEVAKELNIKLRAGIIATGDEFICDEAKKAKIREIFNADACEMEGASVALV
CDALKVPCFILRAMSDKAGEKAEFDFDEFVINSAKISANFVLKMCEKL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagcaattttaggagccatgagtgaagaaatcactcctttacttgaaacactt
aaagattatacgaaaatagaacacgctaataatacttattattttgcaaagtataaaaat
catgaacttgttttagcgtattctaaaatcggcaaggtaaattctactcttagtgctagt
gtgatgatagaaaaatttggcgcacaagtgttgctttttacgggtgttgcaggtgctttt
aatcctgagcttgaaattggtgatttgctttatgcaacaaaattagctcaatacgatctt
gatattaccgcttttggacatcctttgggttttgttccaggtaatgaaatttttatcaaa
accgatgagaaattaaacaatcttgctttagaagttgctaaggaattaaatatcaaactg
cgtgcaggcattattgcaacgggtgatgagtttatttgcgatgaagcaaaaaaagcaaaa
atcagagaaattttcaatgctgatgcttgtgaaatggaaggcgcaagtgtggctttggtt
tgtgatgccttaaaggtgccttgttttatcttaagagctatgagtgataaagcaggggaa
aaagctgaatttgattttgatgaatttgtgatcaattcagctaaaatttcagccaatttt
gtgcttaaaatgtgcgagaaattatga

DBGET integrated database retrieval system