KEGG   Campylobacter jejuni subsp. jejuni M1: CJM1_1100Help
Entry
CJM1_1100         CDS       T01855                                 

Gene name
pglE
Definition
(GenBank) UDP-4-keto-6-deoxy-GlcNAc C4 aminotransferase
  KO
K15910  UDP-N-acetylbacillosamine transaminase [EC:2.6.1.34]
Organism
cjm  Campylobacter jejuni subsp. jejuni M1
Pathway
cjm00520  Amino sugar and nucleotide sugar metabolism
cjm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cjm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CJM1_1100 (pglE)
Enzymes [BR:cjm01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.34  UDP-N-acetylbacillosamine transaminase
     CJM1_1100 (pglE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DegT_DnrJ_EryC1 Aminotran_5 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ADN91294
LinkDB All DBs
Structure
PDB: 

Position
complement(1064949..1066109)
Genome map
AA seq 386 aa AA seqDB search
MRFFLSPPHMGGNELKYIEEVFKSNYIAPLGEFVNRFEQSVKDYSKSENALALNSATAAL
HLALRVAGVKQDDIVLASSFTFIASVAPICYLKAKPVFIDCDETYNIDVDLLKLAIKECE
KKPKALILTHLYGNAAKMDEIVEICKENEIVLIEDAAEALGSFYKNKALGTFGEFGAYSY
NGNKIITTSGGGMLIGKNKEKIEKARFYSTQARENCLHYEHLDYGYNYRLSNVLGAIGVA
QMEVLEQRVLKKREIYEWYKEFLGEYFSFLDELENSRSNRWLSTALIDFDKNELNACQKD
INISQKNITLHPKISKLIEDLKNEQIETRPLWKAMHTQEVFKGTKAYLNGNSELFFQKGI
CLPSGTAMSKDDVYEISKLILKSIKA
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgagattttttctttctcctccgcatatgggcggtaatgaattaaaatatatagaagaa
gttttcaaaagcaattatatagcacctttgggtgaatttgtaaatcgctttgagcaaagt
gtaaaagattatagcaaaagtgaaaatgccttagctttaaattcagctacagcagctttg
catttagctttaagggtggcaggggtaaaacaagatgatattgttttggcttcttctttt
acttttatcgcttcagtggcgcctatttgttatcttaaagcaaaacctgtatttatagat
tgtgatgaaacttataatatcgatgtagatttgttaaaacttgctattaaggaatgtgaa
aaaaaaccaaaagcattgattttaactcatctttatggcaatgcggctaaaatggatgaa
attgttgaaatttgcaaggaaaatgaaattgttttaatcgaagatgctgctgaagcttta
ggaagtttttataagaataaagccttaggaacttttggagaatttggagcttattcttat
aatggcaataaaattatcaccacttcaggtggaggtatgcttataggaaaaaataaagaa
aagattgaaaaagcaagattttatagcactcaagctagggaaaattgtttgcattatgaa
catttagactatggttataattaccgtttaagcaatgttttaggagctattggtgtagca
caaatggaggttttagaacaaagagtgcttaaaaaaagagaaatttatgagtggtataaa
gaatttttaggagagtattttagctttttagatgaattagaaaattcaagaagtaatcgc
tggttaagtacagctttgattgattttgataaaaatgaacttaatgcttgtcaaaaagat
ataaatatcagtcaaaaaaatattactttgcatccaaaaatttcaaaactcatagaagat
ttgaaaaatgaacaaatagaaacaagaccattatggaaagctatgcacactcaagaagta
tttaaaggaactaaggcttatcttaatggcaatagtgagttatttttccaaaaaggaatt
tgtttgccaagtggtacggcgatgagcaaagatgatgtttatgaaatttcaaaactgatc
ttaaagagcataaaggcttaa

DBGET integrated database retrieval system