KEGG   Campylobacter jejuni subsp. jejuni M1: CJM1_1541Help
Entry
CJM1_1541         CDS       T01855                                 

Gene name
hisI
Definition
(GenBank) Histidine biosynthesis bifunctional protein hisIE
  KO
K11755  phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase [EC:3.6.1.31 3.5.4.19]
Organism
cjm  Campylobacter jejuni subsp. jejuni M1
Pathway
cjm00340  Histidine metabolism
cjm01100  Metabolic pathways
cjm01110  Biosynthesis of secondary metabolites
cjm01230  Biosynthesis of amino acids
Module
cjm_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:cjm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    CJM1_1541 (hisI)
Enzymes [BR:cjm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     CJM1_1541 (hisI)
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     CJM1_1541 (hisI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH PRA-PH MazG
Motif
Other DBs
NCBI-ProteinID: ADN91730
LinkDB All DBs
Position
1508295..1508918
Genome map
AA seq 207 aa AA seqDB search
MQNFKELNEKIAWQKVDHLLPVIIQDAKTCEVLMLGFMNNEALEKSLESGKVVFFSRTKQ
RLWMKGEESGNFLNIVDLSLDCDNDTLLILANPVGSTCHTGDISCFEKISKNADFVFLAR
LEKLINARKNADENTSYTAKLFKSGTKRIAQKVGEEGVETALAATVKDKEELICEAADLM
YHLSVLLADANLSFSDVISKLKERHKA
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatttcaaagaacttaatgaaaaaattgcttggcaaaaagtggatcatctttta
cctgtcatcatccaagatgcaaaaacttgtgaagttttaatgctaggcttcatgaataat
gaagccttagaaaaaagcttagaaagtggcaaagtagtctttttttcacgcacaaaacag
cgtctttggatgaagggtgaagaaagtggaaatttcttaaatatcgtagatttaagctta
gattgtgataatgacacgcttttaattttagcaaatcctgtaggatctacttgtcatacg
ggcgatatttcttgttttgaaaaaatttctaaaaatgcggattttgtttttctagccaga
cttgaaaagcttattaatgcacgcaaaaatgccgatgaaaatacttcttatacagcaaaa
cttttcaaaagtggcacaaaacgcatcgcacaaaaagttggtgaagaaggcgtagaaaca
gctttagcagcgacagtaaaagataaagaagagcttatttgtgaagcagcggatttaatg
tatcatttaagtgttttacttgcagatgcaaatcttagtttctcagatgtgatttcaaag
ttgaaagaaagacataaagcttaa

DBGET integrated database retrieval system