KEGG   Campylobacter jejuni subsp. jejuni ICDCCJ07001: ICDCCJ07001_110Help
Entry
ICDCCJ07001_110   CDS       T01372                                 

Definition
(GenBank) 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase
  KO
K18284  adenosylhomocysteine/aminodeoxyfutalosine nucleosidase [EC:3.2.2.9 3.2.2.30]
Organism
cjn  Campylobacter jejuni subsp. jejuni ICDCCJ07001
Pathway
cjn00130  Ubiquinone and other terpenoid-quinone biosynthesis
cjn00270  Cysteine and methionine metabolism
cjn01100  Metabolic pathways
cjn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cjn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    ICDCCJ07001_110
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    ICDCCJ07001_110
Enzymes [BR:cjn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.9  adenosylhomocysteine nucleosidase
     ICDCCJ07001_110
    3.2.2.30  aminodeoxyfutalosine nucleosidase
     ICDCCJ07001_110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PNP_UDP_1
Motif
Other DBs
NCBI-ProteinID: ADT65534
LinkDB All DBs
Structure
PDB: 

Position
128201..128887
Genome map
AA seq 228 aa AA seqDB search
MKIAILGAMSEEITPLLETLKDYTKIEHANNTYYFAKYKNHELVLAYSKIGKVNSTLSAS
VMIEKFGAQALLFTGVAGAFNPELEIGDLLYATKLAQYDLDITAFGHPLGFVPGNEIFIK
TDEKLNNLALEVAKELNIKLRAGIIATGDEFICDEAKKAKIREIFNADACEMEGASVALV
CDALKVPCFILRAMSDKAGEKAEFDFDEFVINSAKISANFVLKMCEKL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagcaattttaggagccatgagtgaagaaatcactcctttacttgaaacactt
aaagattatacgaaaatagaacacgctaacaatacttattattttgcaaagtataaaaac
catgaacttgttttagcgtattctaaaattggcaaggtaaattctactcttagtgctagt
gtgatgatagaaaaatttggcgcacaagctttgctttttacaggagttgcaggtgctttt
aatcctgaacttgaaattggcgatttgctttatgcaacaaaattagctcaatacgatctt
gatattactgcttttggacatcctttgggttttgttccaggtaatgaaatttttatcaaa
accgatgagaaattaaacaatcttgctttagaagttgctaaggaattaaatatcaaactg
cgtgcaggtattattgcaacgggtgatgagtttatttgcgatgaagcaaaaaaagcaaaa
attagagaaattttcaatgcggatgcttgtgaaatggaaggcgcaagtgtggctttggtt
tgtgatgctttaaaggtgccttgttttatcttaagagctatgagtgataaagcaggggaa
aaggctgaatttgattttgatgagtttgtgatcaattcagctaaaatttcagccaatttt
gtgcttaaaatgtgcgagaaattatga

DBGET integrated database retrieval system