KEGG   Campylobacter jejuni subsp. jejuni ICDCCJ07001: ICDCCJ07001_1129Help
Entry
ICDCCJ07001_1129  CDS       T01372                                 

Definition
(GenBank) conserved hypothetical protein
Organism
cjn  Campylobacter jejuni subsp. jejuni ICDCCJ07001
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADT66459
LinkDB All DBs
Position
complement(1145451..1147094)
Genome map
AA seq 547 aa AA seqDB search
MKILLLNENPVVSRLVSLSAKKMSYDFEELNAYSENLGNYDVIVVDSDTPAPLKILKEKC
DRLIFLAPRNQNVEDIDAQILQKPFLPTDFLNLLNNKDVNKHTPIDLPMLSNDENPYADI
SLDLDNLNLDDLPDENSLNINSEGMEDLSFDDDAQDDNANKTLETQNLEDENLEQETTKE
QIQEDIQTDLDLTLEDSKNEKEDLSQKHTALDTEPSLDELDDKNDKDLEIKEDDKNEEIE
KQELLDDSKTNALEVQEELSESQDDNANKTLETQNLEDENLEQEATKEQTQEDIQTDLDL
TLEDSKNEKEDLSQEHTALDTEPSLDELDDKNDEDLEDNKELQANMSDFDDLPVVEEQEK
EMDFDDLPEDAEFLGQAKDSEEPEEFLEEFAPVVEEDVQDEIDDFTSNLSTQDQIKEELA
QLDELDYGIDSDNSSKVLEDFKDEPILDDKELGTNEEEVVVPNLNISDFDALKESDIQEA
LGEEILEKNEEPIVSDATKDDNSEEIVNELSQSIAGAITSSIKDDTLKAALKGMNMNINI
NISFKED
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattttacttttaaatgaaaaccctgtggtttcaagacttgtaagccttagtgct
aaaaaaatgtcttatgattttgaagaacttaatgcttatagtgaaaatttgggtaattat
gatgtgattgttgtagatagcgatactccagcacctttaaaaattcttaaagaaaaatgt
gatagattgatttttttagctccgcgaaatcaaaatgtagaagatatagatgcgcaaatt
ttacaaaaaccttttttacctacagattttttaaatttactgaataataaagatgtaaac
aaacatacgcctattgatttgccaatgttaagcaatgatgaaaatccttatgctgatata
agtttagatttggataatttaaatttagatgatttacctgatgaaaattctttaaatata
aattcagagggaatggaagatttgagttttgatgatgatgcgcaagatgataatgcaaac
aaaactttagaaactcaaaatttagaagatgaaaatttagaacaagaaacaactaaagaa
cagattcaagaagacattcaaactgatttagatttaactttagaagatagcaaaaacgaa
aaagaagacttaagccaaaaacatacagctttggatactgagcctagtttagatgagcta
gatgataaaaatgataaagatttagaaatcaaagaagatgataaaaatgaagaaatagaa
aagcaagaattattagacgattctaaaacaaatgcattagaagtgcaagaagagcttagc
gaatctcaagatgataatgcaaacaaaactttagaaactcaaaatttagaagatgaaaat
ttagaacaagaagcaactaaagaacagactcaagaagacattcaaactgatttagattta
actttagaagatagcaaaaacgaaaaagaagacttaagccaagaacatacagctttggat
actgagcctagtttagatgagttagatgataaaaatgatgaagatttagaagataacaaa
gaattacaagctaatatgagcgactttgatgatcttcctgtggttgaagagcaagaaaaa
gaaatggattttgatgatcttcccgaggatgctgaatttttaggtcaagcaaaagatagt
gaagaaccagaggaatttttagaggagtttgctcctgttgtggaagaagatgttcaagat
gaaatagatgattttacttcaaatttgagcactcaagatcaaatcaaagaagaactagct
caacttgatgagctggattatggtattgatagtgacaatagtagcaaggttttagaagat
tttaaagatgaaccaattttagacgataaagaattaggaacaaatgaagaggaagtggtt
gtgccaaatttaaatataagtgattttgatgcattgaaagaaagtgatatacaagaagct
cttggagaggaaatcttagaaaaaaatgaagagcctatagtaagtgatgcaactaaagat
gataatagcgaagagatagttaatgagcttagccaaagcatagcaggagcgatcacttca
agtattaaagatgataccttaaaagctgctcttaagggtatgaatatgaatataaatata
aacattagttttaaagaggattga

DBGET integrated database retrieval system