KEGG   Coturnix japonica (Japanese quail): 107306063Help
Entry
107306063         CDS       T04297                                 

Gene name
HEXB
Definition
(RefSeq) hexosaminidase subunit beta
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
cjo  Coturnix japonica (Japanese quail)
Pathway
cjo00511  Other glycan degradation
cjo00513  Various types of N-glycan biosynthesis
cjo00520  Amino sugar and nucleotide sugar metabolism
cjo00531  Glycosaminoglycan degradation
cjo00603  Glycosphingolipid biosynthesis - globo and isoglobo series
cjo00604  Glycosphingolipid biosynthesis - ganglio series
cjo01100  Metabolic pathways
cjo04142  Lysosome
Module
cjo_M00079  Keratan sulfate degradation
Brite
KEGG Orthology (KO) [BR:cjo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    107306063 (HEXB)
  09107 Glycan biosynthesis and metabolism
   00513 Various types of N-glycan biosynthesis
    107306063 (HEXB)
   00531 Glycosaminoglycan degradation
    107306063 (HEXB)
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    107306063 (HEXB)
   00604 Glycosphingolipid biosynthesis - ganglio series
    107306063 (HEXB)
   00511 Other glycan degradation
    107306063 (HEXB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    107306063 (HEXB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:cjo03110]
    107306063 (HEXB)
Enzymes [BR:cjo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     107306063 (HEXB)
Chaperones and folding catalysts [BR:cjo03110]
 Intramolecular chaperones
  Others
   107306063 (HEXB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_20 Glycohydro_20b2 Glyco_hydro_20b
Motif
Other DBs
NCBI-GeneID: 107306063
NCBI-ProteinID: XP_015704343
LinkDB All DBs
Position
Z
AA seq 558 aa AA seqDB search
MVRAMGVAGLLLGLLLVPAVLLGASFGRGEPPPDLQPEPSEWGTGSDAVSEDSLWPLPQS
LRTSHLRLQLAPERFQVVHGAGSSAGPGCGILQDAFRRYYEYIFGRSHWRKPHRESPSAQ
GELSQLQVVIASPEPGCNSFPHLASNEAYHLTVSEPVAILKADEVWGALRGLETFSQLVH
EDDYGSFLINESEIYDFPRFAHRGILLDTSRHYLPLKSILTNLDAMAFNKFNVLHWHIVD
DQSFPYQSIFFPELSNKGAYSYNHVYTPTDVRLVIEYARLRGIRVIPEFDTPGHTQSWGK
GQKDLLTPCYSGEQPSGSFGPVNPILNSTYDFMAALFKEISSVFPDAYIHLGGDEVSFDC
WRSNPKVKEFMKKQGFGIDYAKLESYYIQKILDIVSSYNKGYMVWQEVFDNNAQLKPDTV
VEVWMSNNYAHELSSVTRAGFPAILAAPWYLDYISYGQDWTKYYRVEPLNFPGSEKQKKL
LIGGEACLWGEYVDATNLTPRLWPRASAVGERLWSSKNVTDLQDAYRRLTNHRCRMLSRG
IAAEPLFVGYCPHEARWR
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atggtcagagccatgggagtagctgggttgctcctagggctgctcctcgtccccgccgtg
ctgctgggcgccagcttcggccgcggagagccgccccccgacctgcagccggagccgtcc
gaatgggggacgggatcggacgccgtctccgaggactcgctgtggccgctgccgcagtcg
ctccgcacgtcccatctccggctgcagttggcccccgagcgcttccaggtggtgcacggc
gccggctcctcagcgggaccgggctgcggaatcctgcaggacgccttccgcaggtattac
gagtacatcttcgggcgctcccactggaggaagccgcaccgagagtcgccgtctgcacaa
ggggaactgtcgcagttgcaggtggtgatcgcctccccggagcccggctgtaacagcttc
ccgcacctcgcgtccaacgaggcctatcatttaactgtaagtgagcctgtggctatactg
aaagcagatgaagtatggggagctttaagaggtttggaaaccttcagtcagttggttcac
gaagatgattatggaagttttctcatcaatgaatctgaaatctatgacttcccaaggttt
gcacacagaggaatcttacttgacacgtcgaggcactatttgccattgaaatctattctc
acaaacctggatgccatggcttttaacaagttcaatgttcttcactggcatatagtagat
gatcagtcatttccttaccagagtattttttttcctgaacttagtaacaagggggcttac
tcttacaaccacgtctatacccctactgacgtccgtctggtgatcgagtatgcccgatta
aggggcattagagttatcccagagtttgataccccaggacatacacagtcttggggaaaa
ggtcaaaaagatcttctcactccttgttacagtggagaacagccaagtgggtcctttgga
cctgtaaatcccattttaaattcaacttatgacttcatggctgcattattcaaagaaatc
agcagtgtgtttcctgatgcctacatccacctgggaggagatgaagtgagcttcgattgt
tggagatctaaccctaaagtgaaagagttcatgaagaagcaaggatttggcatagactat
gctaaactggaatcatactatattcagaagattttggatattgtttcctcttataacaaa
ggatacatggtctggcaggaagtgtttgataacaatgcacagctgaaaccagacactgta
gttgaagtgtggatgtcaaacaactacgctcacgaactaagcagcgtcactagagcaggg
ttccctgctatcctggcagctccctggtatttggactacattagttatggacaagactgg
acaaaatactaccgcgttgaaccacttaacttccctggatctgaaaaacagaaaaagctc
ttaataggtggagaagcttgtctgtggggagaatatgtggatgcaactaacctcacacca
agattatggcctcgggcaagtgctgtgggagagagactctggagcagcaaaaatgtgacc
gacttgcaggatgcctatagaaggctgaccaaccatcgatgccgcatgctcagcagaggc
atagcagctgagcctctctttgttggctattgtccccatgaagcaagatggcggtga

DBGET integrated database retrieval system