KEGG   Coturnix japonica (Japanese quail): 107306951Help
Entry
107306951         CDS       T04297                                 

Gene name
PFKM
Definition
(RefSeq) phosphofructokinase, muscle
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cjo  Coturnix japonica (Japanese quail)
Pathway
cjo00010  Glycolysis / Gluconeogenesis
cjo00030  Pentose phosphate pathway
cjo00051  Fructose and mannose metabolism
cjo00052  Galactose metabolism
cjo01100  Metabolic pathways
cjo01200  Carbon metabolism
cjo01230  Biosynthesis of amino acids
cjo03018  RNA degradation
Module
cjo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cjo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107306951 (PFKM)
   00030 Pentose phosphate pathway
    107306951 (PFKM)
   00051 Fructose and mannose metabolism
    107306951 (PFKM)
   00052 Galactose metabolism
    107306951 (PFKM)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    107306951 (PFKM)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cjo01009]
    107306951 (PFKM)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:cjo03019]
    107306951 (PFKM)
Enzymes [BR:cjo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     107306951 (PFKM)
Protein phosphatases and associated proteins [BR:cjo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107306951 (PFKM)
Messenger RNA biogenesis [BR:cjo03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     107306951 (PFKM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 107306951
NCBI-ProteinID: XP_015705849
LinkDB All DBs
Position
Un
AA seq 782 aa AA seqDB search
MAQPPKHCGSAEQMGAGKAIAVLTSGGDAQGMNAAVRAVVRVGIYTGAKVYFVHEGYQGL
VDGGDNIKEATWESVSMMLQLGGTVIGSARCQDFRTREGRLKAARNLVKRGITNLCVIGG
DGSLTGADTFRAEWSSLLAELMKTGGITAEEAKKSSYLNIVGMVGSIDNDFCGTDMTIGT
DSALHRIIEIVDAITTTAQSHQRTFVLEVMGRHCGYLALITSLACGADWVFIPESPPEDG
WEDHLCRRLTETRLGGSRLNIIIVAEGAIDRHGKAITADDVKDLVVKRLGYDTRVTILGH
VQRGGTPSAFDRILGSRMGVEAVMALLEGTPDTPACVVSLSGNQAVRLPLMECVQVTKDV
TTAMNEKRFDDAVKLRGRSFQNNWNVYKLLAHIRPPSTKSGYTLAVLNVGAPAAGMNAAV
RSTVRIGLIHGHRMMAVHDGFEGLALGNVEDISWERVGSWTGLGGSKLGTKRTLPKKFFE
EISATISNFGIHGLIIIGGFEAFIGTLELVEGRSKFEELCIIMCVIPATITNNVPGSDFS
IGADTALNTITTTCDRIKQSASGTKRRVFIVETMGGYCGYLATMAGLAAGADAAYIFEEH
FNIHDLQVNVEHLTEKMKTTVKRGLVLRNENCNEHYTTEFLYNLYSSEGKGIFDCRKNVL
GHMQQGGAPTPFDRNFGTKMGAKAVAWITGKIKECSRHGRIFANTADSACLLGMRKRSLV
FQPVTELKDQTDFKHRIPKEQWWLKLRPMLKILAKYNIELDTSEKAHMEHVRQKRISQES
GM
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagcccccgaagcattgcgggagcgctgagcaaatgggtgctggaaaagccatc
gctgtcctcacctcggggggggacgcacaggggatgaatgcagctgtccgcgctgtggtg
cgagtgggcatttacaccggtgccaaagtctacttcgtgcatgagggctaccaggggctg
gtggacggcggggacaacatcaaagaggccacgtgggagagcgtctccatgatgctgcag
ctgggtgggactgtcatcggcagcgcccgctgccaggatttccggacccgcgaaggacgc
ctgaaagctgcccgcaatctggtgaagcgcggcatcaccaacctctgcgtcattggcggc
gacggcagcctcaccggagctgacaccttccgtgccgaatggagcagcctcctggcagag
ctgatgaaaacaggggggatcacagcggaggaggcgaagaagtcgagctacctgaacatc
gtgggcatggtgggctctatcgacaacgacttctgtggcacggacatgaccatcggcacc
gactcagcgctgcaccgtatcatagagatcgtggacgccatcaccaccacggcccagagc
caccagcggacctttgtgctggaagtgatgggtcgtcactgtggttatctggctctcatc
acctctctggcctgtggtgccgactgggtcttcatccccgagtccccccctgaggatggc
tgggaagaccacttgtgccgaaggctcacagagacccgtttgggtggctcaaggctgaac
atcatcatcgtggccgagggcgccatcgacagacacggcaaggccatcaccgctgatgac
gtcaaagacctggtggtgaaacgtttgggctacgacacccgtgtcaccatcctgggccac
gtgcagcgcggtgggacaccctccgccttcgaccgcatcctgggcagcaggatgggagtt
gaagccgtcatggccttgctggaagggacccccgatacccctgcctgcgtcgtcagcctc
tcagggaaccaggccgtgcgcctgcccctcatggagtgcgtgcaggtgaccaaagatgtg
acaacagcgatgaatgagaaacgcttcgatgatgctgtgaagctgcggggccggagtttc
cagaataactggaatgtctacaagctgctggcacacatccgcccaccctccaccaagagt
ggttacacgttggctgtgctcaatgtgggcgccccagctgctggtatgaacgcggccgtg
cgctccaccgtgaggatcggactcatccacgggcacaggatgatggcggtgcacgacggc
ttcgaggggctcgcccttgggaatgtggaagatatcagctgggagagggttggatcctgg
acgggtctggggggatccaaactggggacaaagaggaccttgcccaagaaattctttgag
gaaatcagcgccaccatcagcaacttcggcatccacgggctgatcatcatcgggggcttt
gaggccttcatcggcaccctggagctggtggaagggagatccaagtttgaggagctctgc
atcatcatgtgtgtcatccccgccaccatcaccaacaacgtgcccggctccgacttcagc
attggtgctgacaccgctctcaacaccatcaccacgacctgcgaccgcatcaagcagtcg
gcgtcgggcaccaagcgccgcgtcttcatcgtggagaccatgggaggctactgtgggtat
ctggccaccatggcggggctggcggccggtgctgatgctgcctacatctttgaggagcac
ttcaacatccatgacctgcaggtcaatgtggagcatttaactgagaagatgaagacaacg
gtgaagcgcgggctggtgctcagaaacgagaactgcaacgagcactacaccactgagttc
ctgtacaacctctactcctctgagggcaagggcatcttcgactgccgcaagaacgtgctg
gggcacatgcagcagggcggcgccccaaccccctttgacaggaatttcggcactaaaatg
ggcgccaaggcggtggcttggatcactggcaagatcaaggagtgctcccggcacggtcgc
atctttgccaacacagccgactcagcgtgtctgctgggcatgcgcaagcgcagcctggtc
ttccagcctgtcactgagctcaaggatcagacagacttcaagcaccgcatccccaaggag
cagtggtggctgaagctgcgccccatgctgaagatcctggccaagtacaacatcgagctg
gacacctcggagaaggcgcacatggagcacgtcaggcagaagaggatctcacaggagtcc
ggcatgtga

DBGET integrated database retrieval system