KEGG   Coturnix japonica (Japanese quail): 107307021
Entry
107307021         CDS       T04297                                 

Gene name
LPAR2
Definition
(RefSeq) lysophosphatidic acid receptor 2 isoform X1
  KO
K04291  lysophosphatidic acid receptor 2
Organism
cjo  Coturnix japonica (Japanese quail)
Pathway
cjo04080  Neuroactive ligand-receptor interaction
cjo04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:cjo00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107307021 (LPAR2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107307021 (LPAR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cjo04030]
    107307021 (LPAR2)
G protein-coupled receptors [BR:cjo04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    107307021 (LPAR2)
SSDB
Motif
Pfam: 7tm_1 7tm_4 Rax2
Other DBs
NCBI-GeneID: 107307021
NCBI-ProteinID: XP_015705956
LinkDB
Position
Unknown
AA seq 363 aa
MQCVLPGEQRTELLGLPVAMKHCFYNESVGFFYNNSRKELTTYWRTKDVLVVALGLTVSL
IVLLTNLLVIAAIIINRRFHYPIYYLLGNLAAADLFAGIAYMFLMFHTGPRTAELSLKTW
FIRQSLLDTSLTASVVNLLAIAVERHQTVLTMQLHSKMSNQRVMILIFCIWATALLLGLI
PSYGWHCLCALEECSSMAPLYSRSYLTFWAISNLLVFLLMAVVYAHIFIYVKRKMGRMSA
HTSFHPRYRETVVGLVKTVTIILGAFLICWTPGQVVLLLDGLGCKSCNVLAVEKYVLLLA
EINSLINAIVYSYRDNEMRNTFRRILCSICYRNPKYTPTAVKPNGADRGGLSLNGHFTVD
SSI
NT seq 1092 nt   +upstreamnt  +downstreamnt
atgcagtgtgtgctgccaggggagcagaggacggagctgttgggactgccggtggccatg
aagcactgtttctacaatgagtcggtgggtttcttctataacaacagccggaaggagctc
accacctactggaggaccaaagacgtcctggtggtggccctgggtctcaccgtcagcctt
atcgtcctcctcaccaacctcttggtcatcgccgccatcattatcaaccgccgcttccat
taccccatttattacctcctgggtaacctggcagctgccgacctctttgctggcattgct
tacatgttcctcatgttccacacggggccgaggacggccgagctctccttgaagacctgg
ttcatccggcagagcctcttggacaccagtttgaccgcttcggtggtcaacctcttggcc
atcgcggtggagaggcaccagacggtgctgaccatgcagctgcacagcaagatgtccaac
caacgcgtcatgatcttgatcttctgcatctgggccacggctctgctgctgggcttgatc
ccatcctacggttggcattgcctgtgtgctttggaggagtgttccagcatggctccgctc
tacagccgcagctacttgaccttctgggccatctccaacctcctggtcttcctcctcatg
gcggtggtctacgctcacatcttcatctacgtcaagaggaagatggggcggatgtcggcg
cacacctctttccatccacgctatagggagaccgtggtcggccttgtcaagaccgtcacc
atcatcctcggtgccttcctgatctgttggacccccgggcaggttgtgctgctattggat
gggttgggttgtaagagctgcaacgttttggccgtggagaaatacgtccttctattggcc
gagatcaactcattaatcaacgccatcgtttattcctatcgggacaacgagatgaggaac
actttccgaaggatcttatgctccatttgttataggaaccccaaatataccccgacggct
gtgaaacccaatggggccgaccgtggggggttgtcactgaatgggcatttcacagtggat
tcctccatttga

DBGET integrated database retrieval system