KEGG   Coturnix japonica (Japanese quail): 107307407Help
Entry
107307407         CDS       T04297                                 

Definition
(RefSeq) maltase-glucoamylase, intestinal-like
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
cjo  Coturnix japonica (Japanese quail)
Pathway
cjo00052  Galactose metabolism
cjo00500  Starch and sucrose metabolism
cjo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cjo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    107307407
   00500 Starch and sucrose metabolism
    107307407
Enzymes [BR:cjo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     107307407
    3.2.1.20  alpha-glucosidase
     107307407
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil DUF5110 Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 107307407
NCBI-ProteinID: XP_015706404
LinkDB All DBs
Position
Un
AA seq 1150 aa AA seqDB search
MQVGAFYPFSRNHNTELCAPQDPAYFGADSILVKSSIHYLYIRYTLLPYLYTLFYRAHTQ
GDTVARPLMHEFYSDEASWDVDQQFLWGPALLITPVMDPGVEVIQAYIPDAVWYDYETGA
RISFRKQTAQLYLPADKMGLHLRGGFVVPTQRPNTTTVTSRRNAMGLIVALDDDGTAMGE
LFWDDGESTGTIEGGIYVHYNFSVSNNELHMEVTKNGYTDPNSLKFEEIRILGLENEPTQ
LTVIQGNTVMDPSHNITYRATEKVALITGLQLELGLSYTLRWVLSSGTGTNMKFDCHPES
GATREACEQRGCVWQEDTSPLDIPYCYYGTADNNYGVSELRYTPWGLEANVTLNTPHIGG
TQRSTTPIGTLWLQVIYHSDHLLQFKIYDYANKRYEVPVTLNLPETPMSPIENRMYEVNV
QHKPFGVQIRRRNTGTVXWDSVLPTFTFSDMFIQISTRLPSLYLYGFGETEHTQYHRDMN
WNTWGMFSRDQPPGYKLNSYGVQPFYMGLEEDGNAHGVLLLNSNGMDVTFQPTPALTYRT
IGGILDFYVVLGPTPELVVQQYTELVGRPVMPPYWALGFQLCRYGYENDTEIAQLVEDMK
AAQIPYDVQYTDIDYLERQLDFKLNPRFSGLPELINKIRAEGMRYIPILDPAISANETDY
LAFTRGMEKDVFIKWPNSQDIIFGKVWPDYPNIVVNDSLDWDTAVQFLVFFPFFCCFQDM
NEPSSFVHGAVWGCRDHELNNPPYMPKLGNREDGLAYKTLCMEGVHIMADGSERRHYDVH
NLYGWSQTKPTLDALRRITKERGIVITRSTYPTSGQWAGHWLGDNTAAWDQLYKSIIGMM
EFSLFGVSYTGADICGFFSDSEYELCARWMQLGAFYPFSRNHNGIGNKRQDPVAWNSTFE
SISRDVLNVRYTLLPYLYTLMFQASAYGSTVVRPLLHEFVDDKTTWEIYKQFLWGPALLI
SPVLDKGAVTVNAYFPNARWYNYYTGEYVGFGGEYRDLMTPLDRINLHVRGGFILPLQTP
ANNTAYSRKNPFSLLVALNESQQAEGQLYWDDGVRIDAIEDGVYLLTSFTAHQNTLWIRV
QHRGYSDPNTLRFSSIRVLGQNEAAQQLYVMENGAQLPSQHVVTYNSSTQVLDITQLELE
LGRDYTLEWS
NT seq 3453 nt NT seq  +upstreamnt  +downstreamnt
atgcaggttggggcattttaccccttttccaggaaccacaacaccgagctctgcgccccc
caagatccggcttatttcggtgctgactccatcttggtcaagtcctccatccattatcta
tacatccgctatacgttgctgccttatctctatacgctcttctatagggcccacactcaa
ggggatacagtggccaggcccctaatgcatgagttttactcggatgaagcctcgtgggat
gtggaccagcagttcctatggggccccgcgttgctcatcaccccagtgatggacccgggg
gtggaggtgatccaggcgtacatccctgatgctgtgtggtacgactacgaaacgggagcc
aggatctcgttccgcaagcagacagcgcagctttatctccccgctgataaaatggggctc
catttgagggggggcttcgtggtgcccacccagcgccccaacaccaccaccgtcaccagc
cgcaggaacgccatggggttgattgtggccctggatgacgacgggacggcaatgggggaa
ctcttttgggatgacggcgagtccacgggtacaattgagggtgggatttacgtccattac
aacttcagtgtttccaataacgagcttcatatggaagtgactaaaaacggttacacggac
ccaaattcgctgaaattcgaagaaattcggatcctgggattagaaaatgagccgacccaa
ctgacagtgatacagggcaacacagtgatggatccatcccataatatcacttatagggcc
acggagaaggtggcgctaattacgggcctgcagttggaattgggcctttcctatacgttg
cgttgggttctgagttctggtactggtaccaatatgaagttcgattgccatcccgaaagc
ggagccacgagggaggcgtgtgagcagcggggttgtgtatggcaggaggacacctccccc
ttggacatcccctattgttattatggcaccgcagacaacaactacggggtatcggagctt
cgttacaccccatggggtctggaggccaacgtcaccctaaacaccccccatatagggggc
acccaaaggtccaccacccctataggaaccctatggctccaggtcatatatcacagcgac
cacctcttgcagttcaagatttacgactacgccaataaacgctacgaggtgccggtgact
ctgaacctccccgagaccccgatgagccccatagaaaatcgaatgtacgaggtcaatgtt
caacacaaaccatttggggtccagatccgacgtcggaacaccgggaccgtcatntgggac
tcggttcttcccaccttcaccttcagcgacatgttcatccagatttccacccgtctcccg
tccctttatctctatgggttcggggagaccgaacacactcagtatcaccgcgatatgaac
tggaacacgtgggggatgttcagccgggatcaaccccccggatacaaattgaactcgtac
ggtgtccaaccattttatatggggctggaagaggacggtaacgcgcacggggtcctattg
ctgaacagcaatgggatggatgtaacattccagcccacaccagctctcacctatcgaacc
attgggggtattttggacttttatgtcgttttgggtccaacaccagagcttgttgtccaa
caatacaccgagctggttgggcgaccggtgatgccgccatattgggctcttggattccaa
ttgtgccgttatggatatgagaacgacaccgaaatcgctcagttggtggaagacatgaaa
gcagcccaaattccttacgatgttcaatacactgatattgattacctcgagcgtcaattg
gatttcaagttgaacccgcgtttctccggcctacccgaacttatcaataagatccgtgcc
gaagggatgagatatatccccattttggatccggccatatcggccaatgaaaccgattat
ctcgcttttacgagggggatggagaaggatgtgttcattaagtggcctaactcacaagat
atcatttttgggaaggtctggccggattatcccaatattgtggtcaatgattcccttgat
tgggatactgcagtacagtttctggttttttttccttttttttgttgttttcaggatatg
aacgaaccctccagcttcgtccatggggccgtttggggctgcagggatcatgagctcaat
aaccccccatatatgcccaaattggggaacagagaagacggcctggcctacaaaaccctt
tgcatggagggcgtccatattatggccgacggcagcgagcgccgccattacgacgtccat
aacctctacggatggtcccaaaccaaacctaccttagatgcgttgaggaggatcacgaag
gagagggggatcgtcatcacgcgttcgacgtaccccacaagtgggcaatgggccggacat
tggttgggggacaacacggcggcgtgggaccagttgtacaaatctatcattggaatgatg
gagttcagcctctttggggtatcctacaccggagcggatatttgtgggtttttctctgat
tccgagtacgagctgtgtgcccgttggatgcagctgggggccttctaccccttctcaagg
aaccacaatgggatcggaaataagagacaagaccccgtggcctggaactccacctttgaa
tctatatccagggacgtattgaacgtccgctatacgttattgccgtatctctatacatta
atgttccaggcctcggcctatggcagcaccgtcgtgcgaccgctgctacatgagtttgtg
gatgataaaacaacgtgggaaatttataagcagtttctatgggggccagcgctgcttatc
agccccgtgttagataagggcgctgtgacggtcaatgcgtatttcccgaacgcccgctgg
tataattattacacaggggaatacgtcggttttgggggagaatacagagatttgatgact
ccattggatcgtatcaacctccacgtccgcggcggcttcatcctccccctacagaccccg
gccaacaacacggcctatagccggaaaaacccattttcccttttggtggcgttgaatgag
agtcaacaggcggaagggcagctctattgggacgacggcgtgaggatcgacgccattgag
gacggagtctacctgctgacctcattcaccgcccatcagaacacgctgtggatccgcgtg
cagcaccgcggttactccgaccccaacacgcttcgattcagctccatccgtgtcctgggg
cagaacgaggcggcgcagcagctctatgtgatggagaacggagcccagctgccatcgcaa
cacgtcgtgacatataacagcagcacacaggtccttgacatcacccagctcgaattggag
ttgggcagagattacacgttggaatggagctga

DBGET integrated database retrieval system