KEGG   Coturnix japonica (Japanese quail): 107307430
Entry
107307430         CDS       T04297                                 

Definition
(RefSeq) transcription factor p65-like
  KO
K04735  transcription factor p65
Organism
cjo  Coturnix japonica (Japanese quail)
Pathway
cjo04010  MAPK signaling pathway
cjo04137  Mitophagy - animal
cjo04210  Apoptosis
cjo04218  Cellular senescence
cjo04620  Toll-like receptor signaling pathway
cjo04621  NOD-like receptor signaling pathway
cjo04622  RIG-I-like receptor signaling pathway
cjo04623  Cytosolic DNA-sensing pathway
cjo04625  C-type lectin receptor signaling pathway
cjo04920  Adipocytokine signaling pathway
cjo05132  Salmonella infection
cjo05164  Influenza A
cjo05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:cjo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107307430
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    107307430
  09143 Cell growth and death
   04210 Apoptosis
    107307430
   04218 Cellular senescence
    107307430
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107307430
   04621 NOD-like receptor signaling pathway
    107307430
   04622 RIG-I-like receptor signaling pathway
    107307430
   04623 Cytosolic DNA-sensing pathway
    107307430
   04625 C-type lectin receptor signaling pathway
    107307430
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    107307430
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107307430
  09172 Infectious disease: viral
   05164 Influenza A
    107307430
   05168 Herpes simplex virus 1 infection
    107307430
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cjo03000]
    107307430
Transcription factors [BR:cjo03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    107307430
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 107307430
NCBI-ProteinID: XP_032297702
LinkDB
Position
Unknown
AA seq 366 aa
MFYVLPPPDPKSPPIKPIGVCCPSLSQPEWGQQGPPPLYSDPAVGPAPYVEILEQPKQRG
MRFRYKCEGRSAGSIPGEHSTDSARTHPTIRVNHYRGPGRVRVSLVTKDPPHRPHPHELV
GRHCQHGYYEAELSPERSVHSFQNLGIQCVKKRELEAAVAERIRTNNNPFNVPMEERGAE
YDLSSVRLCFQVWLNGPGGLQMLPPVLSQPIYDNRAPSTAELRICRVNRNSGSCQGGDEI
FLLCDKVQKEDIEVRFWSDGWEAKGSFAAADVHRQVAIVFRTPPFRERSLLHPVTVRMEL
QRPSDRQRSPPLDFRYLPHQGKEKRGGHPYIAPLGSCWEHDVTMGSPTQPWGPKSNYGVL
NPTMGS
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgttttatgtcctccccccccccgaccctaaatccccccccattaaacctataggagtt
tgctgcccctctttgtcacagccggaatggggccagcaggggccaccccccctttattca
gatcccgctgtgggtccagccccatacgtggagatcctggagcagccgaagcagcgcggg
atgaggttcaggtataaatgtgaggggagatcggccgggagcatccccggggagcacagc
accgacagcgcgaggacacaccccaccatacgggtgaaccattaccgtgggccgggtcgg
gtccgtgtctccctggtgactaaggaccccccccatcgcccccacccccacgagctggtg
ggtcggcactgccaacatggctactacgaggccgagctcagccccgagcgctccgtgcac
agcttccagaacctgggcattcaatgcgtaaagaaacgggagctggaagcggctgtagcc
gaaaggatccgaaccaacaacaacccattcaatgtgccgatggaggagcgcggtgccgag
tacgacctgagctcggtgcgactctgcttccaggtgtggctcaatggccccggggggctc
cagatgctgccccccgtcctgtcacagcccatctatgacaaccgtgcccccagcacagca
gagctgcgtatctgccgcgtgaaccgtaactccgggagctgccaggggggggacgagatc
ttcctgctctgcgacaaggtccagaaagaggacattgaggtccgtttctggtccgatggt
tgggaagccaagggcagttttgccgcagccgacgttcaccgtcaggtcgccatcgttttc
cggaccccccccttcagggaacgttccctcctccatcccgtcaccgtccgcatggagctg
caacgaccctcggaccgacagcgcagcccccccctcgacttccgctacctgccccaccag
ggtaaggagaaaagggggggacacccctacatcgccccattggggtcctgttgggagcac
gacgtgaccatggggtccccaacccaaccatggggtcctaaatccaactatggggtccta
aacccaaccatggggtcctaa

DBGET integrated database retrieval system