KEGG   Coturnix japonica (Japanese quail): 107308808Help
Entry
107308808         CDS       T04297                                 

Gene name
SETD2
Definition
(RefSeq) SET domain containing 2
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
cjo  Coturnix japonica (Japanese quail)
Pathway
cjo00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:cjo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    107308808 (SETD2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cjo03036]
    107308808 (SETD2)
Enzymes [BR:cjo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     107308808 (SETD2)
Chromosome and associated proteins [BR:cjo03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107308808 (SETD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRI SET AWS WW
Motif
Other DBs
NCBI-GeneID: 107308808
NCBI-ProteinID: XP_015708430
LinkDB All DBs
Position
2
AA seq 2593 aa AA seqDB search
MKLHRQSLVLRDLPALSAEPLHHYPAADTQKRQNCTHAGNLREEENESKTETVQKAGFIK
GPVFKGVASSRFLPKGTKTKVNLEEQGRQKVSFSFSLTKKTLPNRFLSGLGNEKQNETQN
SPAVPLQTDFNPKIKMDLGDAAGSAEESSPPKPKVELGKIHFKKHLLSVTTKPPPPAAAA
SLLPPPPALAPVTEPVAAATDFASAPPPPPTASPAAPMPVPTAAALPQLPVTLMSTLLLS
PPVEAEVPASKEPCHVVPKEASELDLKQDVVSHGLEEHVTQHMAEQVEVTPQKEDSHIGK
DDEVSDSSKGASLCSRKQGSKRKFSQSDGTMLGSESDEDSVRTSSSQRSHEQKISSAEKE
RDPRKSSSSLRGEELKSSSRSRSDRDEKYSSYSKSERDSRYTSSRSRSDRERRRSRSHSR
SRSDRSSRTSSSYSRSERSHYYESDRRYHRSSPYRERTRYSRSYADSRGRESSDSEDEYR
RTHSRSSDSRRTSSHSSSYRESRTSYSKSDRDSKVESSHADMDRRGRSSSKADRDSKRTS
ESEVTKRCSPLNELGYRKGTSHSKPDSNVNSSSRYKSTPSKTPAPKPDKFKSSFCCTESV
EEIKQQSNSLDLEISCLKSSEIRVSTAKRFEREKTLSPLNQLNDSPTLKKTDESKAAFPH
SGSEDLASSECHDNVKEQETLVSIKHEQLRSCFPIEMNINGSPEGSSDDLAAPSASKAED
VAVSSDDSLCRLEASHVGRTSNSYPLPSNGFESIYVPKEQEPDYSHIQSSECSSLFKEEE
ALVPEQQSEALPSPVVNVDHPKISVKNLDGQTAPCDKTKEPVFCYVSDDATTSLYHSEVE
IEVEPADVKVTSEAFLDLHVEPQTVTCDYESTEDPNSKSACEEEQYHIDTPHQAGLAVDS
SSRDSAQGCYSPDIRQDGPVVTQHLEEDIPSEGDGAPPSCSGTGEVLEVDVQHVDLDSAR
GKMSLEDEHSYYSQVPLEHCSREEAAEEMAVTTERVSPDDLEEQGQVVCAEDDGGNEPMV
ASAFPDASFPSCDVVVAAEEPEAVTQAPTCDSSGGTSEFAPAPHEDYSDTAESDSEPGSD
DSDTEESDSDDGVPRKRLQSVVVVPKNSSIAMEDSSPCSSRSSQGTRRYSDHWDDERPEP
SRPYYEERPEATASNNGPQAESRCSPRGMEKSPASSTELGRKDGEELRADACQPQSDGVD
STSQADLAVDSQGKPNPDERMLNVLMSINRPLGRQEEQPFCVPESFESADKSCHPMSFSK
PDSWQGSGGLHQSGLGDCSREDSFHPVEGMGGMSWELQAEKPSSTYQQPDSSFGVYSGYV
YQPGTGAYSSSQNCWQGNGYWDARSAGRPAGGSYERVQGQVPDSLTEDHEEYEDDRWDDE
CKAGFPSPSSKFHAPGQQETGSVQAHEISSNSSKEPLSVAEKKEEVKALEKNDVKERGPP
KKRRQELESDSESDTDSRERKKVKVEGEQEVAPQDSSMVGRPCIMDDFRDPQRWKEFAKQ
GKMPCYFDLIEENVYLTERKKSKSHRDIKRMLCECPPLSKEERAQGEVACGEDCLNRLLM
IECSSRCPNGDYCSNRRFQKKQHADVEVILTEKKGWGLRAAKDLPSNTFVLEYCGEVLDH
KEFKARVKEYARNKNIHYYFMALKNDEIIDATQKGNCSRFMNHSCEPNCETQKWTVNGQL
RVGFFTTKLVPSGSELTFDYQFQRYGKEAQKCFCGSANCRGYLGGENRVSIRAAGGKMKK
ERSRKKDSVDGELEALLENGEGLSDKNQVLSLSRLMVRIETLEQKLTCLKLIQNTHSQSC
LKSFLECHGLSLLWIWMTELGDSRGSTANNLKLQLEIMKTLELLPIPTKNMLEESKVLPI
IQRWAQTKSAIPQLSEGDGYSSENTSRAHTPLNTPELSAKQSAEGDTDTPKKLVFRRLKI
ISENSMDSAISDTTSELEGKEGKEDLDQLEVAPTEVSEEQQPQQEVKAAVDTPVESSKPQ
ELEAEPEAEVKESNGTKLEEPITMETPSQDEEEGVSDVESERSQEQTDKIVDVSDLASRL
LDSWKDLKEVYRIPKKSQAEKESSADRGREAAGLRDQTPTPKNPVLSRTDPEWQNLNKEK
KRRRDSLSPPASAYERGTKRPEDRYDTPASSKKKVRLKDRNKLSTEERRKLFEQEVAQRE
AQKQQQQLQNLGITSPLPYDSMGYGTPHHSGFIGYPPGYPMQAYVDPSNPNAGKVLLPTP
SMDSMCSPAAYEHPQPMVGHTVESSLPTPQPVPVVQHVATPMEVTTPQYVAQSDTVVHQE
PNVAVLPVPTTTPVQGQNYGVWDSNQQTVAVQQQYSPAQSQPAIYYQGQTCQTVYGVTSP
YSQTTPPIVQSYAQPGLQYIQGQQIYTAHPQGVIVQPPPAVTTIVAAGQPQPIQQPEVVV
TNNLLDLPPPSPPKPKTIVLPPNWKTARDPEGKIYYYHVVTRQTQWDPPTWDSPGDDASL
EHEAEMDLGTPTYDENPMKSSKKPKTAEADTSSELAKKSKEVFRKEMSQFIVQCLNPYRK
PDCKVGRITTTEDFKHLARKLTHGVMNKELKYCKNPEDLECNENVKHKTKEYIKKYMQKF
GAIYKPKEDTDLE
NT seq 7782 nt NT seq  +upstreamnt  +downstreamnt
atgaagttacaccggcaaagtttggtgctcagggaccttccagcactatcagcagagcca
ctgcaccattatcctgctgcagacacccaaaagaggcagaattgcacccatgctggcaac
ctcagagaagaagaaaatgagagcaagactgaaaccgtgcagaaagctggctttatcaaa
ggcccggtgttcaaaggtgttgcttctagtcgctttttgcccaaaggcaccaaaacgaag
gttaaccttgaggagcaaggaagacagaaggtgtctttcagctttagtttaaccaagaaa
accttaccgaacagatttctgtccggtctgggaaacgagaaacaaaatgaaactcagaac
tccccagcagtacccctacagactgattttaaccccaaaattaaaatggaccttggggat
gctgctggttcagcggaggaatcttcacctccaaaaccgaaggtagaactggggaaaatc
cattttaagaaacatttacttagtgtcacaaccaaaccccccccaccagctgcagcagca
tctttattgccgccgccaccggctctggcaccggtaacagaaccagtggcagcggccacg
gactttgcatcggcaccaccacctccaccaacagcatcaccagcagcaccaatgcctgtc
cccactgcggcagctttgccacagctgcctgtcacgctcatgtcaacgctgctgctgtca
ccacctgtagaagcagaagtcccagcttcaaaggagccatgtcacgtagtccctaaggag
gcttcagagctggaccttaagcaggatgtggtatcacacggtttggaagaacatgtaact
caacacatggctgagcaggtggaagtaactccacagaaggaagattcccatattgggaaa
gatgacgaagtttcagacagctccaagggtgcttctttgtgctctaggaaacagggctcc
aaaaggaagttctcccagtccgatggcacgatgctgggctctgagtctgatgaagattcc
gtgaggacttcttccagccagcgctcacatgagcagaagatatccagcgcggaaaaggag
agggatcccaggaaaagctcttcctctctcagaggagaagaactgaagtcctcctcacgc
tccagatcagacagagatgaaaagtattctagctattcgaaatcggaacgagattcgcgg
tatacatcttcccgatccaggtcagacagagagagaaggcgaagccggtcccattctcgg
tcccggtcggatcggagctcccgaactagctcttcctattcaaggtcagagcgctcacat
tactacgaatctgaccgcaggtatcaccggagctccccatacagagagaggacaagatac
tcccggtcatatgcagactccagagggagggagagctctgattcggaagatgaatacaga
aggacgcattccagatccagcgactcgaggcgcacgtcgtcccactcctcctcgtacaga
gagtcaaggacttcttactctaaatcagacagggacagcaaagtagagtcatctcatgct
gacatggacaggagaggaaggtcttcttcaaaagcagatagagattcaaaacggacttca
gaaagtgaagtaaccaaaaggtgctctccccttaacgagctcgggtatcgaaaggggact
tcccattctaagcctgacagtaatgtgaattcttcttcccgttataagtccaccccttca
aagacccccgcaccaaagcctgataaatttaaaagttctttctgttgtacagaatcagtt
gaagaaataaaacagcagtctaattctctagatttagagatctcttgtttaaaaagcagt
gagatcagagtgtccactgcaaaaagatttgaaagggaaaaaacactttctccattaaat
cagttaaatgattcccccactcttaaaaagacagatgaatcaaaagctgcttttcctcac
tcagggtctgaggatcttgcaagcagtgaatgccatgacaatgttaaggagcaagagact
ttagtaagtataaagcacgagcaattgagatcatgtttccctatagaaatgaatataaat
gggtccccagagggtagctctgatgatctggcagcacccagtgcctccaaagcggaggat
gttgcagtgtcatctgatgatagtttgtgtaggttggaagcatcacacgttgggaggacg
agtaactcgtatccgctgccatcgaatggatttgagagcatatatgtccctaaagagcaa
gaacctgactattctcacatacagtccagcgagtgtagcagcctgttcaaggaggaagag
gctctggtcccggagcagcaaagtgaagctctgccttctccagttgtgaatgtagatcat
cccaaaatttcagtgaagaatctggatggtcagacagctccctgtgacaaaaccaaagaa
ccagttttttgctacgtttcagatgatgccactacatctttgtatcattcagaagttgaa
atcgaagttgagccagcagatgtaaaagtgacttctgaggcgtttttggatctgcacgtt
gaaccgcagacggtgacgtgcgactatgaaagcacagaggatccgaattcaaagtctgca
tgtgaagaggagcagtatcacattgacacaccccaccaagctggcctggctgtggatagt
tcaagcagggattctgcccagggctgctattcccctgacatcaggcaggatggtcctgtg
gttacgcagcatctggaggaagatatcccctctgagggggatggggccccaccgagctgc
tcgggcactggggaggtgctcgaggtggatgttcagcatgttgatctggactcggcacgg
ggcaagatgtctctcgaggatgagcattcctattattcccaagtgccactggaacactgc
agcagagaggaggcagcggaagaaatggctgttaccacagagagagtcagtcctgatgat
ctggaagagcaaggccaggtagtttgtgccgaggatgatggagggaatgagcccatggtg
gcttcggcttttccagacgcttcatttccatcttgtgatgttgtggtggctgcagaagaa
ccagaagctgtaacgcaagccccaacgtgtgacagcagtggtggtacctccgaatttgct
cccgctccccatgaggactattctgacacggctgaaagtgacagcgagccgggcagcgac
gacagtgacacagaggagtctgattctgatgatggcgtgccacgaaaacggctgcagtct
gttgtggttgtcccaaagaactcaagcattgcaatggaggatagcagcccctgctcctcg
cggagcagccagggcacacggcgctattccgaccactgggatgatgagaggccagaacca
agcaggccctactatgaggagaggccagaggctacggcgagtaacaacgggccccaggct
gagagcaggtgctctccaagagggatggagaagagtccagcctcatctactgagcttggc
aggaaggatggcgaagagctgcgggcagacgcctgccagccgcagagcgatggtgtggac
agcacgagccaggcagacctggcggtggattctcaaggcaaacccaacccagatgagaga
atgcttaatgtgctgatgtccatcaataggccgcttggccggcaggaggagcagccattt
tgtgtgcctgagagctttgagagcgctgataagtcttgccatccgatgagcttttccaaa
ccagacagctggcaggggagtgggggtctccatcagtctggccttggagactgctccagg
gaggacagtttccatccagtggagggtatgggcggcatgagctgggagctgcaggcggag
aagcccagcagcacctatcagcagccggatagcagctttggggtctactcgggctatgtt
taccagccaggcacaggagcctacagcagctctcagaactgctggcagggcaatggctac
tgggacgcaaggtctgctggccgtcctgctggaggcagctatgaacgagttcaaggacaa
gtgccggattctctaacagaggatcatgaggagtacgaggatgaccgctgggatgatgag
tgcaaggctggcttccccagcccctccagtaaattccatgctcctgggcagcaagagaca
ggctctgtgcaagcccatgagatcagcagcaactcgagcaaagagccgttgtctgtcgct
gagaaaaaggaggaggtgaaggctttggaaaagaacgatgtgaaagagagaggccctccc
aaaaaacgacggcaagagctggagagcgactccgagagcgacacagactccagggagagg
aagaaagtgaaggtggagggtgagcaggaggtggcaccgcaggactcctccatggtcggc
cgtccgtgcatcatggatgacttccgcgacccgcagcgctggaaggagtttgccaagcag
gggaaaatgccctgttacttcgacctcattgaggaaaatgtgtacttgacagaaaggaag
aagagcaaatcccaccgggatattaagcgaatgctgtgtgaatgccctcctctctccaag
gaagaacgagcgcagggggaggttgcttgtggtgaagactgcctgaaccgcctgctcatg
atcgagtgttcctccaggtgcccaaatggtgactactgttccaaccgacgcttccagaag
aagcagcatgcagatgtcgaagtaatcctcactgagaagaaaggctgggggctcagagct
gccaaagatctcccatcaaacacttttgtgttggagtactgcggagaggtgctggatcac
aaagagttcaaggcacgtgtgaaggaatatgcccgcaacaagaacatccactactacttc
atggctttgaagaacgatgagataatagatgctacccagaaaggaaactgctctcgtttt
atgaaccacagctgcgaaccaaactgtgagacacaaaagtggactgtgaatgggcagctc
agagttgggttcttcaccaccaagctggtcccatcaggctccgagctgacctttgattac
cagttccagagatacggcaaagaagctcagaaatgtttctgtggctcagccaactgccgg
ggttacctgggaggagagaacagggtcagcatccgggctgcaggggggaagatgaagaag
gaacgctcccgtaagaaggattcggtggatggggagctggaggcactgctggagaatggg
gagggcctctcagacaagaaccaagttctcagcttgtccaggctgatggtgcgcatcgag
accctggagcagaagctcacctgcctcaagctcatccagaacactcactcacagtcctgc
ctgaagtccttcctggagtgccacggcctgtcactgctgtggatctggatgacagagctg
ggtgacagcaggggaagcacagccaacaacctcaagctgcagctggagattatgaagacg
ctggagctgctgcccatacccaccaaaaacatgctggaggagagcaaggtgcttcccatt
atccaacgctgggctcagaccaagagtgccatcccacagctcagcgaaggtgatggatac
tcgagtgagaacacgtcgcgcgctcacacgccgctcaacacaccagagctgtctgccaag
cagagtgctgaaggagacacggatacccccaagaaactggtattccgaaggcttaagatt
ataagtgagaacagcatggacagtgccatctcggatacaactagtgaactggaagggaag
gaaggcaaagaggacttagaccagctggaggttgccccaacggaagtgtcggaggagcag
cagcctcagcaggaggtgaaagcagctgtggacacaccagtggagagtagtaagccccag
gagctggaggctgagcctgaagctgaggtcaaggagagcaatggcaccaagctggaggag
cccatcacgatggaaacaccgtctcaggatgaagaggaaggagtatctgacgtggagagc
gagaggagccaagagcaaacagacaaaattgtggatgtgagcgatttggccagcaggctg
cttgacagctggaaagacctgaaggaggtgtaccgaatcccaaagaagagtcaagcagaa
aaggagagcagtgctgaccgaggcagagaggctgctggcctcagggatcagactcccaca
ccgaagaaccccgtcctgagccgcacagaccctgaatggcagaacctgaacaaggagaag
aagaggcgacgagactcgctgtcccctccggcatcagcgtatgagcggggcaccaagagg
cccgaggacaggtatgacacgccagcatcctcaaagaagaaagtccgcctcaaggaccgc
aacaagctgtcgacagaggagcgcaggaagctctttgagcaggaggtggcccaacgggag
gcccaaaaacagcaacaacagctgcagaacttgggcatcacgtccccccttccctacgac
tccatgggctatggcacaccgcaccacagcggcttcatcggctacccacccggctacccc
atgcaggcctatgtggaccccagcaaccccaatgcgggcaaggtgctgctgcccacccca
agcatggactctatgtgctccccagcagcatatgagcaccctcagcccatggtggggcac
acggttgaatccagcctgcccactccccagccggtcccagtagttcaacatgtagcaacg
ccgatggaggtgacgactcctcagtatgtagcacaaagcgacaccgtggtgcaccaagaa
cccaacgtggctgtcctgcctgtgcctaccacaacaccagtgcaggggcagaactacggg
gtgtgggattccaaccagcagacggtggctgtgcagcagcagtactcgccagctcagtcc
caacctgccatatattaccagggccagacttgtcagactgtttatggggtgacgtccccc
tactcacagacgaccccaccgattgtacagagctacgcccagccaggcttgcagtacatc
caagggcagcagatatacacagcccacccgcagggagtgatcgtccagcccccacctgcc
gtcaccaccatcgtggcagctgggcagccacagcccatccagcagccagaggttgtggtg
accaacaacctcctggacctgcctccgccatcccctcccaaacccaaaaccatcgtcctg
cctcccaactggaaaacagcccgagaccctgaggggaagatctattactaccacgtggta
acgaggcaaacccaatgggaccctccaacgtgggacagcccaggagatgacgccagcctg
gaacacgaagctgagatggacctcgggaccccaacgtatgatgaaaacccaatgaagtct
tccaagaagcccaagactgcagaagcagacacatcgagcgagcttgccaagaagagcaag
gaagtcttcaggaaagagatgtcccagttcatcgtgcagtgcctcaacccctatcgcaaa
cccgactgcaaggtcggccggatcaccaccaccgaggacttcaagcacctggcaaggaag
ctgactcacggcgtcatgaacaaggagctgaagtactgcaagaacccagaggacctggaa
tgcaacgagaatgtgaaacacaaaacgaaggaatacatcaagaaatacatgcagaaattc
ggggccatttacaaacccaaagaggacacggacttggagtga

DBGET integrated database retrieval system