KEGG   Coturnix japonica (Japanese quail): 107311375
Entry
107311375         CDS       T04297                                 

Gene name
KITLG
Definition
(RefSeq) kit ligand isoform X1
  KO
K05461  KIT ligand
Organism
cjo  Coturnix japonica (Japanese quail)
Pathway
cjo04010  MAPK signaling pathway
cjo04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:cjo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107311375 (KITLG)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107311375 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjo04052]
    107311375 (KITLG)
Cytokines and growth factors [BR:cjo04052]
 Growth factors
  Growth factors (RTK binding)
   107311375 (KITLG)
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 107311375
NCBI-ProteinID: XP_015713323
LinkDB
Position
1
AA seq 287 aa
MKKAQTWIITCFCLQLLLLNPLVKTQNSCGNPVTDDVNDIAKLVGNLPNDYLITLKYVPK
MDSLPNHCWLHLMVPEFSRSLHNLLQKFVDISDMSDVLSNYSIINNLTRIINDLMACLAF
DKNKDFIKENGHLYEEDRFIPENFFRLFNRTIEVYKEFADSLDKNDCIMPSTVETPENDS
RVAVTKTISFPPVAASSLRNDSIGSNTSSNSNKEALGFISSSSLQGISIALTSLLSLLIG
FILGVIYWKKTHPKSRPESNETTQCHGCQEENEISMLQQKEKEHLQV
NT seq 864 nt   +upstreamnt  +downstreamnt
atgaagaaggcacaaacttggattatcacttgcttttgtcttcaactactcttacttaat
cctcttgtcaaaacccagaattcctgcgggaatccagtgacagatgacgtaaatgatatt
gcaaaattggttggaaatctcccaaatgattatctgataacccttaaatatgtcccgaag
atggatagcctgcctaatcactgttggttgcatttgatggtgcctgaattttcaaggagt
ctacataatcttctccagaaatttgtggatatttctgatatgtctgatgttttaagcaat
tattcaatcattaataacctcacaagaataatcaatgatcttatggcatgtctagctttt
gataaaaataaggattttataaaagaaaatggtcacctttatgaagaagatcgcttcatt
cctgagaatttttttaggctctttaataggaccattgaggtctacaaggagtttgcagac
tcactagataagaatgactgcattatgccttcaactgtagaaactccagagaatgattcc
agagtcgctgtcacaaaaacaatttcgtttcctcctgttgctgccagctcccttaggaat
gacagcattggcagtaatactagcagtaacagtaacaaagaggcacttggcttcattagc
agctccagcctgcaagggatcagcatagcattgacatcattgctatctcttctcattgga
tttattttgggagtgatatactggaagaagacacatcctaaatccagaccagaaagtaac
gaaactacacagtgtcatggttgtcaagaggaaaatgagataagtatgttgcagcaaaaa
gaaaaagaacatctacaagtgtag

DBGET integrated database retrieval system