KEGG   Coturnix japonica (Japanese quail): 107311753Help
Entry
107311753         CDS       T04297                                 

Definition
(RefSeq) uncharacterized LOC107311753
  KO
K11253  histone H3
Organism
cjo  Coturnix japonica (Japanese quail)
Brite
Chromosome and associated proteins [BR:cjo03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    107311753
Exosome [BR:cjo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107311753
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CENP-T_C CENP-S CBFD_NFYB_HMF TAF TFIID-31kDa Bromo_TP PAF
Motif
Other DBs
NCBI-GeneID: 107311753
NCBI-ProteinID: XP_015714064
LinkDB All DBs
Position
1
AA seq 336 aa AA seqDB search
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGGSSGQALSYQETCKAPIV
LSAVPRRWEQHSLNRRDPQAPGYQRCAALARFLNLKVSNKKGVSEPANQRGGAYYKVSHG
CSALLFLCGVARVLLCCFRAMARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPH
RYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAY
LVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgtctggcagaggcaaaggcgggaaggggctcggcaaggggggcgccaagcgccaccgt
aaggtgctgcgcgacaatatccagggcatcaccaagccggccatccgccgcctggcgcgg
cgcggcggcgtgaagcgcatctcggggctgatctacgaggagactcgcggcgtgctcaag
gtgttcctggagaacgtcatccgcgacgccgtcacctacaccgagcacgccaagaggaag
acggtcacggccatggacgtggtctacgcgctcaagcgccagggacgcaccctctacggc
ttcggcggttcctctggtcaggcgctctcctaccaagagacgtgcaaggcgcccattgtg
ctctcagcagttcccagacgctgggagcaacattccttgaatcgcagagacccgcaggca
cctgggtaccagcgctgtgctgctttggcgcgctttttgaatttgaaagtgtccaataaa
aaaggggtctccgagccagccaatcagagggggggagcatactataaagtcagccacgga
tgcagcgcgctactattcctctgcggtgttgcacgggtgttgctttgttgtttcagagcg
atggcgcgtacgaagcagacggcgcgtaagtcgacaggcgggaaggcgccccgcaagcag
ctggccaccaaggcggcccgcaagagcgcgccggccacgggcggcgtcaagaagccgcac
cgctaccggcccggcacggtggcgctgcgcgagatccggcgctaccagaagtccacggag
ctgctgatccgcaagctgcccttccagcgcctggtgcgcgagatcgcgcaggacttcaag
accgacctgcgcttccagagctcggccgtcatggcgctgcaggaggccagcgaggcctac
ctggtggggctcttcgaggacaccaacctgtgcgccatccacgccaagcgcgtcaccatc
atgcccaaggacatccagcttgcccgacgcatccgcggggagagggcataa

DBGET integrated database retrieval system