KEGG   Coturnix japonica (Japanese quail): 107312346
Entry
107312346         CDS       T04297                                 

Gene name
ADCY3
Definition
(RefSeq) adenylate cyclase type 3 isoform X3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
cjo  Coturnix japonica (Japanese quail)
Pathway
cjo00230  Purine metabolism
cjo01100  Metabolic pathways
cjo04020  Calcium signaling pathway
cjo04114  Oocyte meiosis
cjo04261  Adrenergic signaling in cardiomyocytes
cjo04270  Vascular smooth muscle contraction
cjo04371  Apelin signaling pathway
cjo04540  Gap junction
cjo04912  GnRH signaling pathway
cjo04914  Progesterone-mediated oocyte maturation
cjo04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:cjo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107312346 (ADCY3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107312346 (ADCY3)
   04020 Calcium signaling pathway
    107312346 (ADCY3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107312346 (ADCY3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107312346 (ADCY3)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    107312346 (ADCY3)
   04914 Progesterone-mediated oocyte maturation
    107312346 (ADCY3)
   04916 Melanogenesis
    107312346 (ADCY3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107312346 (ADCY3)
   04270 Vascular smooth muscle contraction
    107312346 (ADCY3)
Enzymes [BR:cjo01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     107312346 (ADCY3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA DUF1673 Vpu
Other DBs
NCBI-GeneID: 107312346
NCBI-ProteinID: XP_015715143
LinkDB
Position
3
AA seq 1128 aa
MPRNRDFSEPEYSAEYSADYSVSLPSDPEHAVGRTHEVTVRSSGPCLCLPRFMRLTFAPE
SLENLYQTYFRRQRHETLLVLVVFAALFDCYVLLMCAAVYAADKLAPALAAGTGLAAHVL
LFALCKYRLLPERAARRFLPYVLWVLILAQIFCYLGLNFSRSPEASDTVGWQAFFVFSFF
ITLPLRLAPIVLITAVSCGVHTLVLGVSVAQQRQDALDEGTLLRQILSNIAIYLCVITVG
TMSYYMADRKHRKAFLEARQSLEVKLNLEEQSQQQERLMLSILPKHVADEMLKDMKKDPS
QKEMQQFNTMYMYRHENVSILFADIVGFTQLSSSCSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAVCSIMMGLAMVEAISYVREKTKTAVDMRVGVHSGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMDCLKGEFEVEPGEGGSRCE
YLKEKGIVTYLIVVPKQPLRNGINGVKLSLTSSHGGSPLLVNTKERNGSVSLACTSPEEP
DEPDTRVRGTLENGEEDGEAVNPSFPNPRRRLRLRDLAERVIDASQNEQELNKLLNEALL
ERESVQALKGKSTFRLSMRFIDPEMETRYSVEKEKQSGAAFSCSCVVLFFTALVEVFIDP
WLVANYVTFAVGEILLLILTLCSLAAIFPRVFPKKLVAFSTWIDRTRWARNTWAMAAIII
VTMADIVDMLSCQQDYSGTGNGTVVPPRPGGCWEQPKYYSYIAVLALVATIMLVQVSHMV
KLTLMLLITGAAGTVNIYAWEHIFDQYDRHRNQQSIRSSLVPSKYSMTAMIFIVMLSFYY
FSRHVEKLARTLFLWKIDVHDQKERVYEMRRWNEALVTNMLPEHVARHFLGSKKRDEELY
SQSYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDFDALLDEPQFRCITKIK
TIGSTYMAASGVTPDANANGYSTKKESLSDKERWQHLADLADFALAMKVTLMNINYQSFN
NFMLRIGMNKGAVLAGVIGARKPQYDIWGNTVNVASRMESTGVMGNIQVVEETHLILKEY
GFRFVRRGAIYVKGKGELLTFFLKGREKQGSFVNGSSVTLPHQVVDSS
NT seq 3387 nt   +upstreamnt  +downstreamnt
atgccgaggaacagggatttctcggagcccgagtactcggccgagtactccgccgactac
tcggtgagcctcccgtcggaccccgagcacgccgtgggccggacccacgaggtgacggtg
cgcagctcggggccgtgcctctgtctaccccgctttatgcgcctcaccttcgctccggag
tccctggagaacctctatcagacctatttccgtcgccaacgccacgagaccctcctggtg
ctggtggtcttcgctgccctcttcgattgctacgtcctcctcatgtgcgccgcggtctac
gccgccgacaagttggccccggcgttggcagcagggaccgggttggcagcccacgtgttg
ctcttcgccctctgcaaataccggctgctacccgagcgcgctgcccgtcgcttcctgccc
tacgtcctttgggtcctcatcttggcccagatcttctgttatttgggcctcaacttctcg
cgctctcccgaggccagcgacacggtgggctggcaggccttcttcgtcttctccttcttc
atcacgttgcctctacgcctggcgcccatcgtgctcatcaccgccgtgtcctgcggcgtc
cacacgctggtgctcggcgtctccgttgcccaacagaggcaggatgccctggatgagggc
acgctgctgagacagatcctgtccaacatcgccatctacctttgtgtcatcacggtgggc
accatgtcctactacatggctgaccgcaagcaccgcaaggccttcctggaagcacgacag
tcacttgaggtcaagctcaacctggaggaacagagccagcagcaggagcggctgatgctc
tccatcctgcccaagcatgtggcggacgagatgctgaaggatatgaagaaggacccgagc
cagaaggagatgcagcagttcaacaccatgtacatgtaccgccatgagaatgtcagcatc
ctctttgcagacatcgtgggcttcacacagctctcctcatcctgcagtgcccaggagctg
gtgaagctcctcaacgagctcttcgcccgcttcgacaagctggcagccaaataccatcag
ctgcgcatcaagatcctgggtgactgctattactgcatctgtgggctgcccgactaccgg
gaggaccatgccgtctgctccatcatgatggggcttgccatggtggaggccatttcttat
gtgcgggaaaagaccaagacagcggtggacatgcgtgtgggagtgcacagcgggacggtg
ctgggcggcgtgctgggccagaagcgttggcagtacgacgtgtggtccaccgacgtcact
gtggccaacaagatggaggcaggtggcatccctgggcgtgtgcacatctcacagagcacc
atggattgcttgaagggtgagtttgaggtggagccaggtgagggtggctctcgctgtgag
tacctgaaggagaagggcattgtcacctacctcatcgtggtgcccaagcagcctctacgc
aatggcatcaatggggtgaagctgtcactgacctcatcccatggcggctccccactgctc
gtcaacaccaaggagcgcaatggcagtgtcagcttggcgtgcaccagccctgaggagcct
gatgagcccgacaccagggtgaggggtaccctggagaatggagaggaggatggagaggct
gtgaacccatccttccccaacccacggcgccggctgcggctacgggacctggctgagagg
gtaattgatgcatcgcagaatgagcaggagctcaacaagctgctcaatgaggccctcctg
gagcgcgagtctgtccaagcgctgaaggggaagagcaccttccggctctccatgcgcttc
attgaccctgagatggagacgcgctactcagtggagaaggagaagcagagcggtgctgcc
ttcagctgctcctgtgttgtccttttcttcactgccttggtggaggtcttcatcgaccct
tggttggtggccaactatgtgacctttgcggtaggagagatcctgctgctcatcctcacc
ctctgctcattggctgccatctttccccgggtcttccccaaaaagcttgtggccttctcc
acctggattgacaggactcgctgggcacgcaacacctgggccatggctgccatcatcatt
gttaccatggctgatattgtggacatgctcagctgccagcaggactacagcgggacaggc
aatgggacggtggtgccaccacggccaggcggctgttgggagcaacccaaatactacagc
tacatcgccgtgctggccctggtggccaccatcatgctggtgcaggtcagccacatggtc
aagctgactctcatgttgctgatcactggggcagctggcactgtcaacatctacgcctgg
gagcacatcttcgaccagtacgaccgccaccgtaaccagcagagcatcaggtcttcactg
gtcccctccaagtactccatgacagccatgatcttcatcgtgatgctcagcttttactac
ttctctcgccacgtggaaaagctggcgaggacacttttcctctggaagattgatgtccat
gaccagaaggagcgggtctatgagatgcggcgctggaacgaggcccttgtcaccaacatg
ctgcctgagcacgtggcccggcacttcctgggctccaagaaacgggacgaggagctgtac
agccagtcctacgatgagattggcgtcatgtttgcttctctccccaacttcgctgacttc
tacacagaggagagtatcaacaacgggggcatcgagtgcctgcgattcctcaatgagatc
atctctgactttgacgcactcctggatgaaccccaattccgctgcatcaccaaaatcaaa
accatcggcagcacctacatggccgcatctggagtgacccctgatgctaacgccaatggc
tacagcaccaagaaggagagcctctcggataaggagcgctggcagcatttggctgatctc
gccgactttgccttggccatgaaggtgacgctgatgaacatcaactaccagtccttcaac
aacttcatgctgcgcataggcatgaacaagggcgctgtgctggcaggagtcattggtgcc
cgcaaaccacagtatgacatctggggcaacacagtgaatgtggccagcaggatggagtcc
actggtgtgatggggaacatccaggtggtagaagagacacatctcatcctgaaggaatac
ggcttccgcttcgtgcgccgtggggccatctatgttaagggcaaaggagagctgctcact
ttcttcctcaagggccgggagaagcagggctcctttgtcaacggctcatccgtcaccctg
ccccatcaggtggtggacagctcctga

DBGET integrated database retrieval system