KEGG   Coturnix japonica (Japanese quail): 107313741
Entry
107313741         CDS       T04297                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
cjo  Coturnix japonica (Japanese quail)
Pathway
cjo04010  MAPK signaling pathway
cjo04020  Calcium signaling pathway
cjo04144  Endocytosis
cjo04510  Focal adhesion
cjo04540  Gap junction
cjo04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:cjo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107313741 (PDGFRA)
   04020 Calcium signaling pathway
    107313741 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107313741 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107313741 (PDGFRA)
   04540 Gap junction
    107313741 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107313741 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjo01001]
    107313741 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:cjo04090]
    107313741 (PDGFRA)
Enzymes [BR:cjo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     107313741 (PDGFRA)
Protein kinases [BR:cjo01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   107313741 (PDGFRA)
CD molecules [BR:cjo04090]
 Proteins
  107313741 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Herpes_gE Kinase-like
Other DBs
NCBI-GeneID: 107313741
NCBI-ProteinID: XP_015717781
LinkDB
Position
4
AA seq 1087 aa
MGTPPGTFLILGCFLTGPLLTLCQLPLPTIVPDRNEMVVQLNSNFTLKCSGDSEVSWQYP
VTEGSHRIDIRHEENNSGLFVTVLEVGNASAAHTGMYVCYYNHTQVEDGEVEGKDIYIYV
PDPDMPFVPSLPEDQFILVEEGDPTVIPCRTSDPSAEVTLVNSLDKPVYAFYDSKQGFVG
NFLAGPYTCKTTVKGMEFKSDEFLVYILRATSQLPVEIEALKTVYKTGETIVVTCVVFDN
EVVNLQWNYPGKVKEKGLIKLDDIKVPSQKLVYTLTIPDASVKDTGDYECTARHATKEVK
ENKKVVITVHDKGFIHLEPQFSPLEAVNLHEVKNFVVDVQAYPAPKMYWLKDNVTLIENL
TEIVTSSNRVQETRFQSVLKLIRAKEEDSGYYTLVAENEDEVKRYTFSLLIQVPALILDL
VDDHQGSTGRQTVRCLAEGTPLPDVEWLVCKDIKKCSNDTSWTLLTSNVSDIHMEAHLDE
KNMVESQVTFQKVEETLAVRCVARNDLGAVTRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVIIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSSWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDNFLSRHPEKPKKDMDIFGMNPADESTRSY
VILSFENTGEYMDMKQADTTQYVPMLERKEGSKYSDIQRSVYDRPASYKKKSLSESEVNY
LLSDDSSEDLSLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATNEVYEIMVKCWNSEPEKRPSFYHLSEIVESLLPGQYKK
SYEKIHLDFLKSDHPAVTRMRGDCDNTYIGVTYKNEDKLKDRESGFDEQRLSADSGYIIP
LPDIDPVSEDELGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDSSD
LVEDSFL
NT seq 3264 nt   +upstreamnt  +downstreamnt
atgggtactcccccagggacgttcctgatcctgggatgttttctcacaggaccgctccta
acactttgccagcttcctctgccgactattgttcccgacagaaatgagatggttgtacag
ctgaattccaatttcacactcaaatgctctggagacagcgaagtgagctggcagtacccg
gtgactgagggaagccacaggatagacatcagacacgaggagaacaacagtggcctcttc
gtgacagtgctcgaagtcggaaatgcctcagccgctcacacgggcatgtatgtttgctat
tataaccacacgcaagtggaggatggggaagttgaggggaaggacatctacatctatgtg
cctgacccagacatgccttttgtaccttccttaccagaagatcagttcatcctagtagaa
gaaggtgatcccactgttatcccatgtcggacaagtgacccaagtgctgaagtgacttta
gttaacagtttagacaagcctgtctatgctttctatgacagcaaacaaggctttgtaggg
aacttccttgcaggaccgtacacatgcaaaacaacggttaaaggcatggagttcaagtcc
gatgagttcctcgtctatattttaagagctacttcacagctgcctgttgaaattgaagct
ctgaaaactgtctacaaaacaggcgagacgatcgtagtaacttgtgtggtctttgacaat
gaggtggttaatttacagtggaattatcccgggaaagtgaaagaaaaaggtctgataaaa
cttgatgatatcaaagtcccatcgcagaagttggtttacacgttgaccattcctgacgca
tcagtgaaggacacaggggattatgaatgtactgctcgacatgcaaccaaggaggttaag
gaaaataagaaagtagtcattacagttcatgacaaagggttcattcatctagagcctcag
tttagccctttggaagctgtcaatctacatgaagtcaaaaattttgtcgtcgatgtgcag
gcgtaccccgctccaaaaatgtactggttgaaggataatgtgactctgattgaaaacctt
actgagattgttactagttcaaacagagtccaggaaacacggtttcaaagtgtactaaaa
ttgatccgggccaaggaagaagacagtgggtactatactttggttgctgaaaatgaagat
gaggttaagagatacaccttctccttgctaatacaagttccagccttgatcttagacctt
gtggatgaccaccagggctccactggcaggcagacagtgaggtgcttggctgaagggacc
ccgcttcctgatgtggaatggttggtttgcaaggacattaaaaaatgcagcaatgacact
tcctggactcttctgactagcaacgtctctgatatacacatggaagcccacttggatgag
aagaatatggtggaaagccaggtgaccttccagaaggtagaggaaaccctggctgtcaga
tgtgtagcaagaaacgaccttggcgctgttactcgggaactgaaacttgtggctcccacc
ttgcgatcagaactgacggtggctgctgctgtcttagtactcttggtgattgtgataatt
tcactgattgtcctggtcatcatctggaagcagaagccaaggtacgagataagatggaga
gtcattgagtctatcagccccgatggccatgaatatatttatgtggacccaatgcagctc
ccttatgactccagctgggagtttcctcgagatgggttagtgcttggtcgaatccttggt
tctggtgcatttggaaaagtggtggaagggacagcatatggattgagtcgttctcaacca
gtgatgaaagtagctgtgaaaatgctaaaacctacagctagatccagcgaaaaacaagct
ctgatgtctgaactgaagataatgacacatcttgggccccacctgaacattgtgaacctg
cttggagcttgtacaaaatcaggacctatttacataatcactgaatactgcttttatggt
gatttggtgaactatctacacaagaacagggacaacttcctcagccgacatccagagaaa
ccaaagaaagacatggatatttttgggatgaacccagctgatgaaagcacaagaagctat
gtgattttatcatttgaaaacactggagaatacatggacatgaaacaagctgatacgact
cagtacgtgccaatgctggaaaggaaggaaggatctaaatattctgatattcagagatct
gtatatgatcgacctgcttcatataagaagaaatctttgtcagaatcagaagtaaattac
cttctttcggatgacagttcagaagatctgagcctgctggatttgctaagcttcacctac
caggttgcacggggaatggaattcttggcttctaaaaattgtgtacaccgtgacttggca
gctcgtaatgtccttctggctcaaggcaaaatcgtgaagatctgtgactttgggttggct
agagacatcatgcatgattccaactacgtctccaagggcagcactttcctcccagtaaaa
tggatggcacctgaaagcatttttgacaatctgtacacaacattaagcgatgtctggtct
tatggtattctgctgtgggaaatattttctcttggtggcacaccatatcctggcatgatg
gtcgactccactttctacaataagataaagagtggctaccgaatggcaaaacctgatcac
gctaccaatgaagtgtatgagatcatggtaaagtgctggaacagtgaaccagagaaaaga
ccttcattttatcatttgagtgaaattgtggagagcttgttgcctggacagtacaaaaag
agctacgagaaaattcacctggacttcctgaaaagtgatcacccagctgttactcgaatg
agaggagactgtgacaacacctacattggtgtcacctacaagaatgaagacaagttaaag
gatagagagagcggatttgatgagcagaggctgagtgctgacagtgggtacatcatcccc
ctgcctgacattgaccctgtttctgaagatgagcttggcaaaaggaacaggcacagttcc
cagacttctgaagaaagcgccattgaaactggttccagtagctctacttttatcaagaga
gaggatgagaccattgaggacattgacatgatggatgacatcgggattgactcctcggat
ctggtggaggacagcttcctgtaa

DBGET integrated database retrieval system