KEGG   Coturnix japonica (Japanese quail): 107314428
Entry
107314428         CDS       T04297                                 

Gene name
CCND1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
cjo  Coturnix japonica (Japanese quail)
Pathway
cjo04068  FoxO signaling pathway
cjo04110  Cell cycle
cjo04115  p53 signaling pathway
cjo04218  Cellular senescence
cjo04310  Wnt signaling pathway
cjo04340  Hedgehog signaling pathway
cjo04371  Apelin signaling pathway
cjo04510  Focal adhesion
cjo04530  Tight junction
Brite
KEGG Orthology (KO) [BR:cjo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107314428 (CCND1)
   04340 Hedgehog signaling pathway
    107314428 (CCND1)
   04371 Apelin signaling pathway
    107314428 (CCND1)
   04068 FoxO signaling pathway
    107314428 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107314428 (CCND1)
   04115 p53 signaling pathway
    107314428 (CCND1)
   04218 Cellular senescence
    107314428 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107314428 (CCND1)
   04530 Tight junction
    107314428 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 107314428
NCBI-ProteinID: XP_015719121
LinkDB
Position
5
AA seq 292 aa
MEHQLLCCEVETIRRAYLDANLLNDRVLQTMLKAEETCSPSVSYFKCVQKEILPYMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSFEPLKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPDELLQMELLLVNKLKWNLAAMTPHDFIEHFLTKMPLAEDTKQIIRK
HAQTFVALCATDVKFISNPPSMIAAGSVVAAVQGLHLGNTNTFLSYQCLTHFLSQVIKCD
PDCLRACQEQIESLLESSLRQAQQHNVSSETKTVEDEADLSCTPTDVRDVNI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaacatcagctgctgtgctgcgaggtggagaccatccgacgagcctacctggacgcc
aacctgctcaatgacagggtgctgcagaccatgctgaaggcggaggagacctgctcgccc
tcggtgtcctacttcaagtgcgtgcagaaggaaatcctgccatatatgaggaaaatagtc
gccacttggatgctggaggtctgcgaggagcagaagtgcgaagaggaagttttccccttg
gcgatgaattatttggacagatttttgtctttcgaacccctcaagaaaagccggttgcaa
ttgctcggagctacctgcatgtttgtggcttccaaaatgaaggaaacgattcctctgacc
gcggaaaaactgtgcatttacaccgacaactccatcagacccgacgagttactgcaaatg
gagctgctgctggtgaataagctgaaatggaatctggctgcaatgaccccccacgatttc
attgaacatttcctcactaaaatgcctctggcagaggacaccaaacagatcatccgtaaa
catgctcagacttttgtggctctgtgcgctacagatgttaaatttatttcaaacccacct
tccatgatcgcagctggcagtgtggtagcagctgtgcaaggcctgcatctggggaacact
aacactttcctctcctatcaatgcctcacacatttcctatcacaagttatcaaatgtgat
ccggattgtttacgagcctgccaagaacagattgaatccctccttgaatccagtctacgc
caggcacagcagcacaacgtatcttcagaaacaaagactgtagaggacgaagcagacctt
tcctgcacacccactgatgtgcgagatgtgaacatttaa

DBGET integrated database retrieval system