KEGG   Coturnix japonica (Japanese quail): 107314752Help
Entry
107314752         CDS       T04297                                 

Gene name
GANC
Definition
(RefSeq) glucosidase alpha, neutral C
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
cjo  Coturnix japonica (Japanese quail)
Pathway
cjo00052  Galactose metabolism
cjo00500  Starch and sucrose metabolism
cjo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cjo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    107314752 (GANC)
   00500 Starch and sucrose metabolism
    107314752 (GANC)
Enzymes [BR:cjo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     107314752 (GANC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110 NtCtMGAM_N POC3_POC4
Motif
Other DBs
NCBI-GeneID: 107314752
NCBI-ProteinID: XP_015719816
LinkDB All DBs
Position
5
AA seq 914 aa AA seqDB search
MEAAAQGEASIQDEAVDKSNFKECSQIAFYRRQKLLHPGKSLYRALLDTVTLSDKNVKFH
IIHEENKVLLQVEIYEIEGNIFRLKINEAAPLRARYEVPDVLIKEPATQKLSMSQKEGGV
LVLTSVNEDYKLRVTANPFQAELQFKDETVLSMNSNGLLYFEHLQPPPCDRNPTAENEEA
AGDSSKDNQEDLCLWQEKFGSFLDVKAHGPSSVGMDFSLHGFDHLYGIPQHTESLLLKNT
SDGDAYRLYNLDIFGHKIHDKTGIYGSVPLLIAHKPDRTLGIFWLNSSETLVDINTKAVA
EHIPTESAADISKQRAVPLTDVRWMSESGIIDVFLLMGPTAFDIFKQFAQLTGTQALPPL
FSLGYHQCRWNYEDEQDVKTVDAGFDEHDIPYDVIWLDIEHTDGKRYFTWDKKKFQNPKR
MQELLRKKKRKLVVIVDPHIKADPMYTLYSQGKEKGYFVKDRNGKDFEGICWPGSSHYLD
FTNPEVRKWYADQFAFKTYKGSTNILFVWNDMNEPSVFKGAELTMQKDAVHYNNWEHREL
HNLYGFYQQMATAEGLIKRSSGKERPFVLTRSFFAGSQKYGAVWTGDNTAEWGYLKISIP
MLLTISMAGISFCGADVGGFIGDPEPELLVRWYQAGAYQPFFRGHSNMKSKRREPWLFGE
KNTQIIREAIRERYVLLPYLYTLFYRAHTEAEPVMRPLWIEFPEKLETFGVEDEYMLGNA
LLVYPVTDKEAKAVNVLLPGSKEVWYDFRKFKRMEDQGTLKIPVTLENIPIFQRGGTVIP
LKTAAGKSTEWMTSISYELRVALNTEACAVGELYLDDGHSFQYLHKKQFLYRKFAFHKNI
LSSSCTDESGQYRTTCVVERVVFLGLGQQPTVVTACSKGGKEKEAVFTYDTKTAVLILEN
LALRVDSDWEICIK
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atggaggcggccgcgcagggggaagccagcattcaagatgaagctgtggacaaaagcaac
tttaaggagtgcagccagattgctttctacagacgtcagaaacttctacatcctggaaaa
tccttgtatcgagcactgttggatacagtcacattaagtgacaagaatgtcaaattccac
attatccatgaggagaataaggttcttctacaagttgaaatctatgaaatagaaggcaat
atttttaggcttaaaattaatgaggcagctcctctcagagcaagatatgaagttcctgac
gttcttataaaggaacctgccactcagaaactctctatgtcccagaaggagggaggtgtt
ttggtgctgacaagtgttaatgaggactacaagcttcgagtcacagcaaaccctttccag
gctgagctacaattcaaggatgagactgttctgagcatgaattccaatgggttgttatat
tttgaacatctacaaccccctccctgtgatagaaaccctacagcagaaaatgaggaggca
gcaggtgattcctctaaggataatcaggaggatctatgtctctggcaagagaaatttggc
agtttcttagatgtcaaagctcatggtcctagttctgtaggcatggacttctctttacat
ggatttgaccatctttatggaataccacaacacacagaatcacttcttctcaaaaacaca
agtgatggtgatgcgtaccgactttataatttggacatctttggccacaagatacatgac
aagacaggtatttatggttcagtgccacttctcatagcacacaagcctgacagaacattg
gggatcttctggctgaattcttcagaaacactggtggatattaatacaaaggcagtagct
gagcacatacccaccgaatctgctgcagatatttctaagcagagggcagtgcctctaacc
gatgtgcgctggatgtcagaaagtggaatcattgatgtttttctgctgatgggacccaca
gcatttgatatcttcaagcagtttgcacaactgacaggcactcaagcactacctcccctc
ttttctctgggctaccatcagtgccggtggaattatgaagatgaacaagatgtcaagaca
gttgatgcgggttttgatgaacatgacattccttatgacgtgatatggctggacatagaa
catacagatggcaagaggtatttcacctgggacaagaaaaaattccagaaccccaagaga
atgcaagaacttctcaggaagaaaaaacgcaagcttgtcgtcattgtagatccccatatt
aaagctgatcctatgtataccctgtattcacaggggaaggaaaagggttattttgtgaaa
gacaggaatggaaaagatttcgagggaatctgttggccaggttcctctcactatctggat
ttcaccaatcctgaagtgcgaaaatggtatgcagatcaatttgccttcaaaacatacaag
gggtccactaatatcctctttgtgtggaatgacatgaacgagccatcagttttcaaaggg
gcagagctaacaatgcagaaagatgctgtgcactacaacaactgggagcatcgggaactg
cacaacctctatggattctaccagcaaatggcaactgctgaaggactcatcaaacgttct
tctggaaaagagagaccatttgttctcacacgatctttctttgctggatcacagaagtat
ggggcagtgtggaccggagacaacacagcggagtggggttacctgaaaatctccattcca
atgcttctcaccatcagcatggcagggatttcattctgtggagctgatgtgggagggttc
attggagatccagaaccagaattacttgttcgctggtatcaggctggagcctaccagccc
ttcttcagaggtcattctaacatgaagagcaaacggcgagaaccgtggctctttggggag
aagaacacccagatcatcagggaagccattagagagcgctacgtcctcctgccatactta
tacacactgttctatcgggcacacacagaggctgaaccagttatgaggcctctctggata
gagttcccagagaaattagaaacttttggagtggaagatgagtacatgctaggaaatgct
ttgttggtgtatccagtcacagacaaagaggccaaggcagtgaatgttctgcttccaggc
tcaaaggaggtttggtatgatttcagaaaattcaaacgaatggaagatcaaggcactctg
aagatcccagtaacactggagaatatacccatattccagcgagggggcactgtgatacct
cttaagactgcagctggaaaatccactgaatggatgacaagtatttcttatgagctccgc
gtggcactgaacacagaggcctgtgcagtaggtgagctctacctggatgatggacattca
tttcagtatctccacaaaaagcagttcctgtaccgaaaatttgcttttcacaagaacatt
ctctcttccagctgcacagatgagagcgggcaataccgaaccacatgtgtagtcgagcgg
gtggtatttctgggacttggacaacaacccactgttgtgacagcctgttccaagggtggg
aaagaaaaagaagcggttttcacatacgatacgaagactgctgtgctgattctggaaaat
ttagccctgagagttgacagtgactgggagatttgcatcaagtga

DBGET integrated database retrieval system