KEGG   Coturnix japonica (Japanese quail): 107315078Help
Entry
107315078         CDS       T04297                                 

Gene name
CTAGE5
Definition
(RefSeq) CTAGE family member 5, ER export factor
Organism
cjo  Coturnix japonica (Japanese quail)
SSDB OrthologParalogGFIT
Motif
Pfam: SH3_2 NPIP SH3_9 DUF1664
Motif
Other DBs
NCBI-GeneID: 107315078
NCBI-ProteinID: XP_015720539
LinkDB All DBs
Position
5
AA seq 1384 aa AA seqDB search
MSGILDHRIFLLALSFLTSLRSTKVLSEWKKCGDWECEMAMSRVQATTDYVGPDCRYLSF
KTGEEITVYSKLSRKNEDLWIGSKGKDFGYFPKDAVKVEEVLIAEEVEVLTKETDFLCLD
GDAYVFENEDSVLHYQNKESEYSSSDAESELQETELLKHLGDSIQNEEAIESVFGNGSKE
SQSQGSASKKLVSENENRNEDVEQPELQSSLPLEPVPTQSSWMVSDIAGWFATGSKNDEE
TLKAITEPSEENSYQGRKLAVAADNDLEEPNDQEEQEPTASGWLQGGLTDFLYFGKENVN
VDLESENNVEIQDVSSVDAHSYNEHETAVTELLTEKEQNSESQESTSNWFSLGLSNVLSF
GQAEKNTVATEDHASKEREDDASKNEEIQTLNQQESHSDKESSETFKEVLDEADVSYTQE
VIDSNSNMPNAREITASVYTLSDTKNISSNTGSSSDKLIGDKEHPVDPCSSGQDVASVSQ
LLKNTEEKNPESERSYGQPGAGSKRRLLEEKPEDKYEMDARIDSERHSEEIEIPSVNSEE
KMPSLGADFQHDGEKPSSDNTFQVQNYIPDNDGGWINQILLCLSAFEMGELVKSVFSATT
TIVKEAVASLPEDMRPGPDLYGFPWELVIAVGVVGAFTIFLFLYRSYQSVRSRLYAGREK
QLANKIAELVEEKCKILEKLSLSKKELEDLELSLKDDSLMKESDASLFEETQEKLKKSNL
KLNQEIENLEKELEEEKSKQSENDKLVAEIQERLESLEKESKSIQSQVAEAKSTLKVYQI
NTERLKTSLQDAIDENRQLQESEKQLLQEAEGWGERFSELNEQTKMFESSKADTEEVLKD
KESRVKSLTQYLLKMKDWSSAVRDDDDTEDNHWDTDLKDETENGEHLDDQQKRTIKKLIY
AAKLNACLKTMETERDQMYSKLSDESKAKGELTERIENLQSEQVSLQCENERLESEVQKL
QQKLKVMTELYQENEMKLHRKLTVEERERLQKEEKLSKVDEKITHAAEELNSYRERAKDL
EEELERTIRSYENQITSHEKKAHDNWLTARAAERQLNDIRKENAHNRQKLTEAEFKLDLL
EKDPYALDVPVRPFREHSPYGPSPMGRPSSETRAFLSPPTLLEGPLRLSPMLPGAGGGRG
SRGPGSTVMYEASNERGDMSSDRLTDPHRPPSDTGSLSPPWDRERRIILPPSGEPYTDSV
LPPRRQERFFPPNTGRLSGPAELRTYNMQSFDKTDGQTSSENSPLTEPSGNEMKDNSNLS
NSLPDQLLVSESEAVGSGFAPPPFLPVRPPMMPMDPRGPFMRGPPFPPHPPAGIYGPREC
FPVRDLGPPRPPLPMRNPFPMRSFPHYPPQRPDFLPPPLPPENRIEPPQSKTSATEQPEP
QQET
NT seq 4155 nt NT seq  +upstreamnt  +downstreamnt
atgtcagggatattggatcacagaattttcctgctggcactttcatttttgacaagccta
cggagtacaaaggtactttcagaatggaagaaatgtggtgattgggaatgcgagatggca
atgagcagagttcaagccactacagactacgtgggacctgactgccggtatctgagcttc
aaaacaggggaggagataactgtatactccaaactttccaggaaaaatgaagatttgtgg
ataggaagtaaaggaaaagattttggatatttcccaaaagatgctgtgaaggttgaggaa
gttttaattgcagaagaagttgaagtactcactaaggaaactgatttcctttgtcttgat
ggtgatgcgtatgtttttgaaaacgaagacagtgtgttacattatcagaacaaagaaagt
gaatattcatcatctgatgcagaatcagagctgcaagaaactgaactcttaaagcattta
ggagactccatccaaaatgaagaagcaattgaatcagtttttggaaatggttccaaagaa
tctcagagtcaggggtctgcaagcaaaaaattggttagtgaaaatgagaacagaaatgaa
gatgttgaacagccagaactccaaagtagtctcccattggagcccgttccaactcagtct
agttggatggtttctgacattgcagggtggtttgccacaggaagtaaaaatgatgaagag
accttaaaagccattactgaaccttcagaagaaaacagttatcaaggcagaaaattagca
gtagcagctgacaatgacttagaggagccaaatgatcaggaggagcaagagcccacagca
tctggttggcttcagggtggactgacagattttctgtattttggtaaagagaatgtgaat
gttgacttggaatcagaaaataatgtagaaatccaggatgtttctagtgtagatgctcac
tcctacaatgaacatgaaacagcagttacagagttattgacagaaaaagaacaaaacagt
gagagtcaagaatccacatccaattggtttagtttgggtttaagcaatgttctgagtttt
gggcaggctgagaagaatacagttgctacagaagaccatgcaagcaaagaaagagaagat
gacgcaagtaagaatgaagaaatacagactttaaaccagcaagaatcacactcagacaaa
gaatcaagtgagacgttcaaagaagtgttagatgaagcagatgtgagttacacacaagaa
gtaatagattcaaacagtaacatgccaaatgccagggagataacagcaagtgtgtatacc
cttagtgacaccaaaaacatctcaagcaacacgggatcatcttctgataaattaataggt
gacaaagaacatccagttgacccctgcagttcaggacaagatgtggcatcagtaagtcaa
ctgctaaaaaacactgaagaaaaaaatccagagtcagaaaggagctacggccagccagga
gcaggcagtaaaagaaggctgctggaagaaaagccggaggataaatatgaaatggatgca
cgtattgacagtgagcgacattcagaagagatagaaattccttcagtaaattctgaagaa
aaaatgccaagcttaggagctgattttcaacatgatggtgaaaagccttcctcagataac
accttccaagttcagaactacattccagataatgatggaggctggataaatcagatactt
ctgtgcctgagtgcttttgagatgggggaactggtaaagtctgttttttcagctactaca
actattgttaaagaggctgtggcatcgctgcctgaagacatgagacccggacctgatctc
tatggtttcccttgggaactagtgatcgctgtcggcgttgttggagccttcacaattttc
ctgttcctgtatagaagctatcagtcggtcagaagccggctttatgcaggaagggaaaaa
cagcttgccaataaaattgctgaactagttgaagagaaatgcaaaattcttgagaaactc
agccttagcaaaaaagagttggaagacttagaattgtctctaaaggatgacagccttatg
aaagaatcagatgcatctctttttgaggaaacgcaagaaaaactgaagaaatcaaacttg
aaactcaaccaagaaatagagaatctggaaaaggaactggaagaagaaaaatccaagcaa
tcagaaaatgataaattggtggctgaaattcaggaaagactggaatctttggagaaggaa
tccaagtctatccaatcacaagttgctgaggccaagtccaccctaaaagtgtatcagatt
aatacagagagactcaagacatctcttcaagatgcaatagatgaaaaccgacagcttcag
gagagtgagaaacagcttttacaagaagcagaaggatggggtgaacgatttagcgaacta
aatgaacaaactaagatgtttgaatcatctaaagcagatacagaagaagtactgaaggat
aaagagagtcgagtcaagtcactgacacagtacttgttaaagatgaaagactggagttca
gcagtcagagatgatgatgacactgaagataaccactgggacaccgatttaaaggatgaa
acagaaaatggagagcatttagatgatcagcaaaaacgaaccataaagaaactgatctat
gctgcaaagttaaatgcttgtttaaagaccatggaaacagaaagagatcaaatgtattca
aaactgtctgatgaaagtaaagctaagggagaacttacagagcgtatagaaaacctccaa
agtgaacaagtttccttacaatgtgaaaacgaacgtttggaaagtgaagttcaaaagctt
cagcagaaacttaaagttatgactgagctttatcaagaaaatgaaatgaaactacacaga
aaactgacagtagaagagagagaacgcctacaaaaagaagaaaagctttctaaagtagat
gagaaaattactcatgctgctgaagaactaaacagctacagagagcgagcgaaagatctg
gaagaagagctggaacgaaccattcgctcttatgagaatcagattacttcacatgagaag
aaagctcatgataattggctgacagctcgtgcagctgagagacaactcaatgatataaga
aaagaaaacgctcataacagacagaaattaactgaagcagaatttaaacttgacctttta
gaaaaagatccttatgctcttgatgttccagtcagaccattcagagagcattccccatat
ggaccctcaccaatgggccggccttcatctgaaacaagagcttttctttcccctccaact
ttattggagggtcctttaaggctttcacctatgcttccaggtgcaggaggaggaagagga
tctagaggaccaggatctactgttatgtacgaagccagtaatgaacgaggagacatgagt
tctgatagattaactgatccccacagaccaccatcagatactggatccctgtctcctccc
tgggacagagaacgcaggatcattctgcctccatcaggtgagccttatactgattcagtt
cttcctcctcgaagacaagaaagattcttccctccaaatactggaagactttctggtcca
gcagagctgcggacttacaatatgcagtcttttgataagacagatgggcagacgtcttca
gaaaatagcccactgacagaaccaagtggaaatgagatgaaagataattctaatcttagc
aactctctccctgatcagttgctggtatctgaaagtgaagcagtcggctcagggtttgct
cctccacctttccttccagtcagacctccaatgatgcctatggatccccgagggcccttc
atgagaggacccccttttcctccccatccccctgctggcatctacggaccacgtgaatgt
tttccagtacgagacttggggcctccacgccctccactgccaatgagaaatccgtttccc
atgagatcttttcctcactatccacctcagcgacctgacttcttgcctccacccctacct
cctgaaaacagaattgagccacctcagtcaaagacatcggccacagaacaaccagaacca
cagcaagagacttga

DBGET integrated database retrieval system