KEGG   Coturnix japonica (Japanese quail): 107315213
Entry
107315213         CDS       T04297                                 

Gene name
CACNA1C
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
cjo  Coturnix japonica (Japanese quail)
Pathway
cjo04010  MAPK signaling pathway
cjo04020  Calcium signaling pathway
cjo04260  Cardiac muscle contraction
cjo04261  Adrenergic signaling in cardiomyocytes
cjo04270  Vascular smooth muscle contraction
cjo04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:cjo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107315213 (CACNA1C)
   04020 Calcium signaling pathway
    107315213 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    107315213 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107315213 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    107315213 (CACNA1C)
   04270 Vascular smooth muscle contraction
    107315213 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:cjo04040]
    107315213 (CACNA1C)
Ion channels [BR:cjo04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107315213 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH CAC1F_C PKD_channel DUF4834
Other DBs
NCBI-GeneID: 107315213
NCBI-ProteinID: XP_015720807
LinkDB
Position
1
AA seq 2211 aa
MFQALVRQAYQPLSSHQQGESETKYKGKLVHETQLNCFYIKPGGSNYGSPRPAHANMNAN
AAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTASSTQRKRQQYGKQKKQG
TTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPEDDSN
ATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILE
QATKADGGNSIGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIAL
LVLFVIIIYAIIGLELFMGKMHKTCYHVQGGLIDTPAEDDPSPCAPQSAHGRQCQNGTEC
KAGWEGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWVNDAIGRDWPWIYFVTLIIIG
SFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENE
DEGMDEEKPRNMSMPTSETESVNTDNVPGTDIEGENCGARLAHRISKSKFSRYWRRWNRF
CRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEHYNQPDWLTEVQDTANKVLLALFTAEML
LKMYSLGLQAYFVSLFNRFDCFIVCGGILETILVETKIMSPLGISVLRCVRLLRIFKITR
YWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNF
PQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIA
VDNLADAESLTSAQKEEEEEKERKKLARTASPEKKQEIEKTAVEEETKEEKIELKSITAD
GESPPATKINMDDYQPNENEEKSPYPTTEAPAEEDEEEPEMPVGPRPRPMSELHLKEKAV
PMPDASAFFIFSPNNRFRVHCHRIVNDNIFTNFILLFILLSSISLAAEDPVRHLSFRNQV
LFYFDIVFTVIFTIEIALKILGNADYVFTSIFTLEIILKVTNLSAFLHKGSFCRNYFNIL
DLLVVSVSLISFGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNI
VVVTTLLQFMFACIGVQLFKGKLYSCTDSSKQTEAECRGYYITYKDGEVSQPMIQPRSWE
NSKFDFDNVLTAMMALFTVSTFEGWPELLYRSIDSHMEDVGPIYNHRVEISIFFIIYIII
IAFFMMNIFVGFVIVTFQEQGESEYKNCELDKNQRQCVEYALKARPLRRYIPKNQYQYKV
WYVVNSTYFEYLMFVLILLNTICLAMQHYGQSCMFKEAMNILNMLFTGLFTVEMVLKLIA
FKPKGYFSDPWNVFDFLIVIGSIIDVILSETNHYFCDAWNTFDALIVVGSIVDIAITEVN
PAENTQCSSSMNAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVA
LLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLFRCATGEAWQEIMLA
CLPDKKCDPESEPANSTEADHSCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTR
DWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLV
SMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAIIKKIWKRTSMKLLDQV
VPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNALSLQAGLRTLHDIGPE
IRRAISGDLTAEEELDKAMKEAVSAASEDDIFRRAGGLFGNHVSYYQSDGRSAFPQTFTT
QRPLHINKSGNNQGDTESPSHEKLVDSTFTPSSYSSSGSNANINNANNTALCRFPSPPSY
PSTVSTVEGHGTPLSPTIRVQEAPWKLPSKSSSSRDSQLAIVCQEEVSQDETYDENLNED
IEYCSEPSLLSTEMLAYQDDENRQLTPPENNKGEDTRHSPKKGFLCSSALGRRASFHLEC
LKRQKNQGVDVSQKTVLPLQMVHHQALAVAGLSPLLQRSHSPTTFSRLCATPPATPCSRG
WPQQPIPTLRLEGAESSEKLNSSFPSVHCSSRFPDSSDCGSPRRARPVSLTVPSQTAGSS
RQFHGSASSLVEAVLISEGLVQFAQDPKFIEVTTQELADACDMTIEEMENAADNILNGNS
KQSPNGNLLPFVHCRDAGQDSAGEEEEEVQNPDCRKSQEELKDSRIYISSL
NT seq 6636 nt   +upstreamnt  +downstreamnt
atgtttcaagccttggttcggcaagcataccaaccgctatccagccaccagcaaggggaa
tctgaaacgaagtacaaggggaagctggtgcatgaaactcagctcaactgcttctacatc
aaacctggaggttccaactatgggagtccccgtccagctcatgccaacatgaatgctaat
gcagctgcagggcttgccccggagcatatccctacaccaggggcagctctgtcctggcaa
gctgcaattgatgctgccaggcaagccaaattgatgggtagcgctggcaatgcaacaata
tccacggctagctccacgcagagaaaacgacagcagtatgggaaacagaaaaaacagggt
accacgacagctacgcgtcctcctcgggcactgctgtgtttaacactgaaaaatcccatc
cggagggcatgcatcagcatcgtcgaatggaaaccatttgaaataattattttactgact
atttttgccaattgtgtggccttagctatctatatcccctttccagaagatgattccaat
gccaccaattccaatctggaacgagtggaatatctctttctcataatttttacagtggaa
gcatttttaaaagtaatagcatatggacttctctttcaccccaacgcttacctccgcaat
ggctggaatttactagattttataattgtggtagtagggctttttagtgcaattttagaa
caagcaaccaaagcagatggggggaattcaataggaggaaaaggtgccggatttgatgtt
aaagcactgcgggctttccgagtattacgtcccttacgactggtgtctggagtccctagt
ctccaggtggttttaaattcaattatcaaggccatggtccctttgttgcatattgccctg
ctggtgctgtttgtcatcattatctatgccatcattggattggagttattcatgggaaag
atgcataagacctgctaccacgtgcaaggggggctgatagatacgcctgcagaagatgac
ccatctccctgtgccccccagtctgcacatgggcggcagtgccagaatggaaccgagtgt
aaggcaggctgggagggacccaagcacggcattacgaactttgacaattttgcttttgcc
atgctgacagtgtttcagtgcatcacgatggaggggtggacagatgtactctactgggtc
aatgatgccataggaagggactggccctggatctattttgttacactaatcatcataggg
tcattttttgtacttaacttggttctcggtgtacttagcggggaattttccaaggaaaga
gagaaggctaaggctcgtggagatttccagaagttacgagaaaagcaacagctagaggag
gatttgaagggctatttagactggataactcaagcagaagatattgacccagaaaatgaa
gatgaaggcatggatgaggagaagcctcgaaacatgagcatgcccaccagtgagaccgag
tccgtgaacacagacaacgtccctggaacagatattgaaggcgaaaactgcggtgctagg
ctagcgcatcggatctccaaatctaaatttagccgctactggcgccgatggaatcgattc
tgcagacgaaagtgccgtgctgctgtcaagtccaatgttttctactggctggtgatcttc
cttgtgtttctgaacacccttaccattgcctctgaacactacaaccagccagactggctc
acggaggttcaagacactgccaataaggtgctgctagctcttttcacggcagagatgctg
ctgaagatgtacagccttggtctccaggcctattttgtgtccctcttcaaccgcttcgac
tgtttcatagtgtgtggaggaatcctggaaacaattctggttgagacgaagatcatgtca
ccactgggcatttctgtcttgagatgtgttcgtctattaagaatatttaaaattacaaga
tattggaactccctgagtaacctagtggcttcactcctgaattcagtccgttccattgcc
tctctcctgctgcttctcttcctcttcatcatcatcttctcactgctggggatgcagctt
tttgggggcaagtttaactttgatgaaatgcagaccaggaggagtacatttgacaacttc
ccccagtctctcctcactgtgtttcagatcctgactggggaggactggaattcggtgatg
tacgatgggatcatggcttatgggggcccctccttccctggcatgctggtctgtatctac
ttcatcatcctcttcatctgtgggaactacatcctgctgaatgtatttttggccattgct
gtggataaccttgctgatgcggagagtttaacatctgcacagaaggaggaggaagaggaa
aaagaaaggaaaaagctagctaggactgctagtcctgaaaagaaacaggagatagagaaa
acagctgtggaggaggagacaaaggaggagaaaattgagctgaaatcaatcactgctgat
ggagaatctccacctgctacaaagatcaacatggatgactatcagccaaatgaaaatgaa
gaaaagagcccatatcccacaacagaagcaccagcagaggaagatgaggaagaacctgaa
atgcctgtgggccctcggcctcgcccaatgtctgagctgcacctcaaagaaaaggctgtg
cccatgcctgatgccagtgcttttttcatcttcagtcctaacaacaggtttcgtgtccac
tgccaccgaatcgttaatgataacattttcaccaactttatcctgctcttcatcttgctc
agcagcatctccttggcagctgaggaccccgtccgacacctctcctttaggaaccaagtt
ctcttttattttgatatagtttttactgtcattttcaccattgaaattgctctgaagatc
ctaggcaatgcagactatgtcttcactagtatctttacattagaaattattcttaaggta
accaatctgagtgctttcctgcataagggctccttctgcagaaactatttcaacatctta
gacctgctggttgtcagcgtttctctcatctcttttggaattcaatccagtgccatcaat
gtggtgaagatcttgcgtgttctgcgagtgcttagaccactgagggccatcaacagagcc
aaaggactaaagcatgtggtccagtgtgtgtttgttgccatccgaaccattggtaacatt
gtggttgtcacaacgttgctgcagttcatgtttgcctgcattggagttcagttgtttaag
ggcaaactctacagctgcactgatagctccaagcagactgaagcagaatgcagagggtac
tacatcacatacaaggatggtgaggtcagtcagccaatgatccagccccggagctgggag
aacagcaagtttgacttcgacaatgtcttgactgccatgatggccctcttcactgtctca
acctttgagggctggccagagttgctgtataggtccattgattcccacatggaggatgtg
ggacccatctataatcacagggttgagatctccatcttctttattatctacatcatcatc
attgccttcttcatgatgaacatcttcgtcggcttcgtcatcgtcacattccaggagcag
ggggagagcgagtacaagaactgcgagctggacaagaaccagcgccagtgcgtagagtat
gctctgaaggcccggcccctgcggaggtacatcccaaaaaaccagtaccagtacaaagtt
tggtatgtggtcaactccacctattttgaatacctgatgttcgttttgatcctgctgaac
accatctgtctggccatgcaacactacggtcagagctgcatgttcaaggaagccatgaac
atcctcaacatgctcttcactggcctcttcactgtcgagatggtcctgaagttaattgcc
ttcaaacccaagggttactttagtgatccttggaatgtttttgacttcctcatcgtaatt
ggcagcattatagacgtcattctcagtgaaactaatcactatttctgtgatgcatggaat
acatttgacgccttgattgttgtgggtagcattgttgatatagcaatcaccgaggtgaac
ccagctgaaaatacccaatgctcttcctctatgaacgcagaggaaaactctcgcatctca
atcaccttcttccgactcttccgcgtgatgcgtcttgtgaagctcctgagccgaggggag
ggcatccggacactgctttggaccttcatcaagtccttccaggctctcccctatgtggct
cttctaatagtgatgctgttcttcatctacgctgtcatcgggatgcaggtatttggtaag
attgcgctgaacgataccacagaaatcaaccgcaacaacaacttccagaccttcccccaa
gcagtgctgctgctcttcaggtgtgccaccggtgaggcctggcaggaaatcatgctggcg
tgtctcccagacaagaagtgtgacccagagtctgagccggccaactccactgaagctgac
cactcctgtggcagcagctttgctgtcttctacttcataagcttctacatgctctgtgcc
ttcctgatcatcaatctttttgtagctgttataatggataactttgattacctgacccgg
gactggtccattttaggaccacaccacctagatgagtttaaaaggatctgggcagagtat
gaccccgaagccaagggacggattaagcacttggacgtggtgacattgctccggcggatt
cagcctccactgggcttcgggaagctttgccctcaccgagtggcttgcaaacgccttgtc
tccatgaatatgccactgaacagcgatggaactgtcatgttcaatgctactctctttgca
ctggtcagaactgcactgaggatcaagacagaaggtaacttggagcaagccaatgaagag
cttagagcaataattaagaaaatctggaagcgtaccagtatgaagctgctggaccaggtg
gtgcctcctgcaggtgatgatgaggtgactgttgggaagttctacgccactttcctgatt
caagagtatttccggaagttcaaaaaacgcaaagaacaaggcctggtgggcaagccttcc
cagcgcaacgcactctccttgcaggctggtttgcgcacacttcacgacattggtccagag
atccgacgagcgatctctggagacctgacagcagaggaagagctagataaggctatgaaa
gaagctgtttctgctgcctctgaagatgatatcttccggagagccggaggcttgtttgga
aaccatgtcagctattaccaaagtgatggcaggagtgcattccctcagacattcaccacc
cagagacctttgcacatcaataagtctggcaacaaccagggagataccgagtctccatct
catgagaagttggtggactccaccttcactcccagcagctactcatcttcaggctccaat
gcaaacatcaacaatgccaacaatactgccctgtgccgcttcccaagcccacctagctac
cccagcactgtcagcacagtggaaggccatggaactccgctgtcacccaccatacgtgtg
caagaagctccttggaaactgccttccaaaagctccagttccagagacagccagctggca
attgtttgccaagaggaagtgtctcaggatgagacttatgatgaaaatttgaatgaagac
attgagtactgtagtgaaccaagtctgctctctactgaaatgctcgcataccaagatgac
gaaaacagacaacttactccaccagaaaacaacaaaggagaggacacccggcactctccg
aagaaagggtttctgtgctcctcagcactaggtcgacgagcgtcttttcacttagagtgt
ctgaagagacagaaaaaccagggcgtagatgtctcgcagaagacagttctgcctttacaa
atggtacatcatcaggcactggcagtggccggcctgagccccctcctccagcgaagccat
tcccctaccacgttctcccggctgtgtgccacaccgcctgctacaccctgcagccgaggc
tggccacagcagcccatcccaacgctgcgccttgagggggctgagtccagcgagaagctc
aatagcagcttcccatccgtgcactgcagttcccggttccccgacagctcagactgtggc
agcccaaggagagccaggccagtgtccctcaccgtccccagccagacagcggggagcagc
aggcagttccacggcagcgccagcagcctggtcgaagcggtattgatttcggaaggactg
gtgcagtttgctcaagatccaaagttcattgaggtcacgacccaggaactcgctgacgcc
tgcgacatgacgatagaagagatggaaaacgcagcagacaacattctcaatggtaacagc
aagcagagccccaatggcaacctgttgccttttgttcactgcagggacgcagggcaggac
agtgcaggcgaggaagaggaagaggtgcagaacccggattgtagaaaaagtcaggaggag
ctgaaggacagcaggatttatatcagcagcctgtag

DBGET integrated database retrieval system