KEGG   Coturnix japonica (Japanese quail): 107315533
Entry
107315533         CDS       T04297                                 

Definition
(RefSeq) prostaglandin D2 receptor
  KO
K04332  prostaglandin D2 receptor
Organism
cjo  Coturnix japonica (Japanese quail)
Pathway
cjo04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:cjo00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107315533
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:cjo04030]
    107315533
G protein-coupled receptors [BR:cjo04030]
 Rhodopsin family
  Lipid
   Prostaglandin
    107315533
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 107315533
NCBI-ProteinID: XP_015721468
LinkDB
Position
5
AA seq 362 aa
MAADGYRCRESRFIASGQSVVPSSALFAAGLLGNVLALLLLGQHRRRSRSAAGRAPRVSA
FYVLVSGLAVTDLLGKCLLSPIVLAAYAYNRSLSELGTGGRGESEPGALCQLFAFLMAFF
GLAPTLLLLAMATECWLSLGHPYFYRRHVTRRRGAMLCALGAALCALFCALPLLGFGAPM
QYCPGTWCFIRMAGGGPSQLGFPVLYASVLGVLVLAIAACNVCSMRQLYGMARRQPRRGA
QPPGPAPPRMEELDHLVLLGLMTALFTICSLPLIVRAYMGAFAADFNEDADLSALRFLSV
NSIVDPWVFIIFRTSVFRLFVRRLCRRLGSRRGTLKSTGPGGDGQFCPLGWREPGSPQLV
FP
NT seq 1089 nt   +upstreamnt  +downstreamnt
atggcggccgatgggtaccgctgccgggagagccgcttcatcgccagcgggcagtcggtg
gtgcccagctcggctctgttcgccgccgggctgctgggcaacgtgctggctttgctcctc
ttggggcagcaccgacggcgctcccgttccgccgccggccgcgctccgcgggtctccgcc
ttctacgtgctggtgagcgggctggcggtcaccgacctgctgggcaagtgcctgctcagc
cccatcgtgctggccgcctacgcctacaaccgcagcctgagcgagctgggaacgggcggc
cgcggggaaagcgagccgggagcgctgtgccaactcttcgccttcctgatggcgttcttc
gggctggcccccaccctgctgctgctggccatggccaccgagtgctggctgtcgctggga
cacccgtacttctaccggcggcacgtcacccggcgccggggagcgatgctgtgcgcgctg
ggcgccgctctgtgcgctctgttctgcgctctgccgctgctcggcttcggcgctcccatg
cagtactgccccgggacgtggtgcttcatccgcatggcgggcggcgggccgagccagctg
ggcttccccgtgctgtacgccagcgtgctgggcgtgctggtgttggccatcgcggcttgc
aacgtgtgcagcatgcggcagctgtacggcatggcccgcaggcagccccggcgcggagcg
cagccccccggcccggccccgccgcgcatggaggagctcgaccacctggtgctgctgggg
ctcatgaccgcgctcttcaccatctgctcgctgccgctcatcgtccgtgcctacatgggg
gcgttcgccgccgacttcaacgaggacgccgacctcagcgctctgcgcttcctctccgtc
aactccatcgtggacccgtgggtcttcatcatcttccgcacctccgtcttccgcctcttc
gtgcgccgcctgtgccgccgcctgggctcccgccgaggcacgctgaagagcacggggccg
gggggggacgggcagttctgtcccctgggatggcgtgagccgggcagcccgcagctcgtc
ttcccctga

DBGET integrated database retrieval system