KEGG   Coturnix japonica (Japanese quail): 107316388Help
Entry
107316388         CDS       T04297                                 

Gene name
HDAC4
Definition
(RefSeq) histone deacetylase 4
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
cjo  Coturnix japonica (Japanese quail)
Pathway
cjo04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:cjo00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    107316388 (HDAC4)
Enzymes [BR:cjo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     107316388 (HDAC4)
Chromosome and associated proteins [BR:cjo03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     107316388 (HDAC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln
Motif
Other DBs
NCBI-GeneID: 107316388
NCBI-ProteinID: XP_015723266
LinkDB All DBs
Position
7
AA seq 1086 aa AA seqDB search
MSSQSHPDGLSGRDQPVELLNPPRVNHMPSSVDVSTALPLQVAPTSVPMDLRLDHQFPMP
VTEPTLREQQLQQELLALKQKQQIQRQILIAEFQRQHEQLSRQHEAQLHEHIKQQQEMLA
MKHQQELLEHQRKLEQHRQEQELEKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEFVL
NKKKALAHRNLNHCISSDPRFWYGKTQHSSLDQSSPPQSGVSGTYNHPVLGMYDSKDDFP
LRKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVVTALKKRPLDVTDSACNSAPGSGP
SSPNNSSNNISAENGITGSVTSIQAETSLAHRLVNREGSVTQLPLYTSPSLPNITLGLPA
TGPSSGGSAQQDAERLAIPALQQRISLFPGTHLTPYLSTTALERDGGTTHNPLLQHMVLL
EQPTAQTPLVTDWYLSGLPLHAQSLVGGERVSPSIHKLRQHRPLGRTQSAPLPQNAQALQ
QLVIQQQHQQFLEKHKQQFQQQQLHINKIISKPNEPARQHESHPEETEEELREHQALLEE
PYSDRVSSQKDVPGLANVVQVKQEPIESDEEEVEPQQELESGQRQAEQELLFRQQALLLE
QQRIHQLRNYQASLEAAGMPVSFGGHRPLSRAQSSPASATFPMSVQEPPTKPRFTTGLVY
DTLMLKHQCTCGNTNSHPEHAGRIQSIWSRLQETGLRGKCECIRGRKATLEELQTVHSEA
HTLLYGTNPLNRQKLDSKKLLGSLTSMFVRLPCGGVGVDSDTIWNEVHSSGAARLAVGCV
IELVFKVATGELKNGFAVVRPPGHHAEESTPMGFCYFNSVAIAAKLLQQRLNVSKILIVD
WDVHHGNGTQQAFYNDPNVLYISLHRYDDGNFFPGSGAPDEVGTGAGVGFNVNMAFTGGL
DPPMGDTEYLTAFRTVVMPIANEFAPDVVLVSSGFDAVEGHPTPLGGYNLSAKCFGYLTK
QLMGLAGGRVVLALEGGHDLTAICDASEACVSALLGNELDPLPEKVLQQRANANAVHSME
KVIEIHSKYWHSLQRYASTVGYSLIEAQKCENEEAETVTAMASLSVGVKPAEKRPDDEPM
EEEPPL
NT seq 3261 nt NT seq  +upstreamnt  +downstreamnt
atgagctcccaaagccatccagatgggctttctggcagagaccagccagtagagctgttg
aatccacctagagtgaaccacatgcccagctctgttgatgtgagcacagcactgcccttg
caagttgccccaacctcagtcccgatggatctgcgcctggaccaccagttccccatgcct
gtgacagagccaacgctccgtgagcagcagctgcagcaggagctcctggccctgaagcag
aagcagcagatccagaggcagatcctcattgctgagttccagcggcagcatgagcagctc
tcccggcagcacgaggcccagctgcacgagcacatcaagcagcagcaggagatgctggca
atgaagcatcagcaggagctgctggagcaccagaggaagctggagcagcaccggcaggag
caggagctggagaagcagcaccgagagcagaaacttcaacagctgaaaaacaaagagaaa
ggaaaggagagtgcagtggcaagcacggaagtaaagatgaaattacaagaatttgtctta
aataagaagaaggctttggcacaccggaatctcaaccactgcatttccagtgaccctcgc
ttctggtacgggaagacacagcacagctccctggaccagagctccccacctcaaagtggc
gtatctggcacctacaatcaccctgtcctggggatgtatgattccaaagatgacttccca
ctcagaaaaacagcatccgaacccaacctgaaattacgatccagactaaagcagaaagtt
gctgaaagacggagcagcccgctgttgcgcaggaaggatggcccggtggtcactgctctg
aagaagcgcccgctagatgtcacagactctgcatgcaacagtgctcctggatctggtccc
agctctccaaacaacagctccaataacataagcgctgagaatggaattacaggatcagtc
acgagtattcaagcagagaccagcctggctcaccgactggtgaatcgcgaaggctccgta
acgcagcttccactctacacgtctccttctttgcccaacatcacactaggactgcctgcc
accggcccttccagtggaggatccgcgcagcaggatgctgagagacttgctatcccagcc
ttgcagcagcggatctctttatttcctggcacccacctcactccctacttgagcactaca
gcgttggaaagagatgggggaaccacacacaaccctcttctgcagcacatggtcttactg
gagcagccaactgcacaaactcccttagtcacagactggtatctttcaggactgcccctc
cacgcacagtctctggttggtggagaacgggtctccccttcaatacacaaactccggcag
catcgcccactggggcgcacgcagtctgctccccttccccagaacgcccaggccctccag
cagttagtgatccagcagcagcaccagcagttcttggagaaacacaaacagcaattccag
caacagcaactgcacatcaacaagataatatcaaaacccaatgagccagctcgccagcat
gaaagccacccggaggagacagaagaagagcttcgagaacaccaagcccttttggaggag
ccatacagcgacagagtctcaagccaaaaggatgtcccagggctggctaatgtggtgcag
gtaaagcaagaacccatcgagagcgatgaggaggaagttgagccgcagcaggagctggag
tctgggcagaggcaggctgagcaggagctgcttttccgccagcaagccctcctgttggag
cagcagcgcattcaccagctgagaaactaccaggcatcgctggaggcagctggcatgccc
gtctcctttggaggccatcggcccctgtcccgtgcacagtcctcacccgcctcggctacc
ttccctatgtccgtacaggagccacccactaagccaaggttcactacaggccttgtctat
gacaccttgatgctgaaacatcagtgtacctgtggaaacacaaacagccacccggagcac
gcggggaggatccagagcatctggtcccggctgcaggagacaggtctccgtggcaagtgc
gagtgcattcgtggaagaaaagcaactctagaagagctgcagacagttcactcggaagct
catacgctgctgtatggcacaaaccctctgaacagacagaaactggacagcaagaaactt
ctaggttctctaacgtcgatgtttgtcaggcttccttgcggtggtgtcggggtcgacagt
gacacaatctggaatgaagttcactcatctggtgctgctcgtctggctgtgggctgcgtc
attgagcttgttttcaaagtggccacaggagaactgaagaacggatttgctgttgttcgg
cctccaggtcaccatgcagaagaaagcacacccatgggcttctgctattttaactctgtg
gcaattgcagccaagctgctccagcaaagactgaacgttagcaaaatcctcatagtggac
tgggatgtacaccacgggaacggtactcagcaagctttttacaacgatcctaatgttctt
tatatttcactacatcgctatgatgatgggaacttctttccaggcagtggtgctcctgat
gaggttggcacaggagcaggagttgggttcaatgttaacatggcctttactggtggcctt
gatccaccaatgggagacacagaatacttaactgctttcagaacggtcgtaatgcccatt
gccaatgagtttgccccagatgttgtgctggtgtcatctggttttgacgcagtggaaggc
catccaacgcctctgggaggatataacctgtctgcaaaatgctttgggtacctgacgaag
cagctgatgggcctggctggaggccgcgtcgtcctggcccttgaaggaggccacgacctg
actgccatttgcgatgcctcagaagcatgtgtttctgctttgctgggaaacgagcttgac
cctcttccagaaaaggttctccagcagagagcaaatgctaatgcagtgcattcaatggag
aaagtgattgagatacacagcaagtattggcattcactccagcgctacgcctcgaccgtg
ggctactccctgattgaagcacagaagtgtgagaatgaagaggccgagacagtgacagcc
atggcttctctgtcagtcggcgtgaagccagctgagaagcgacctgatgatgaacccatg
gaagaggaacctcccctgtag

DBGET integrated database retrieval system